<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26294

Description Uncharacterized protein
SequenceMAAMEGIQDQSQQQQQQQAAPPKPAVERLNPAVQQQLNLESVKTRAISLYKAISRILEDIDAVARANAVPKWQDILGQFSMVNLELFNIMEDIKKVSKAFVVHPKNVNVENSTILPVMLSSKLLPEMETDDNFKKEQLLHGMQNLPISVQIEKLKTRIDMIGAACESAEKVLAETRKAYCFGTRQGPTMVPIDKVQAAKIQEQENLLRAAVNFGEVLRIPLDQRKITSTLPMHLVDVLTVGDGVQTFSDASGMYMKNTPPQSSINATQGLLQASGAQLIGRSAASPSGPTGATSFDNTTTSPLPYANSPRSGTNMMNTPSPQQQTQHQQQQQQQQQQQQQQRQKLMQHMSPHQQQLLAQQIRQSSMPGLGQNQLPQLHDLQGQAQQKFQPLPGQQQMQFSQTMGHQQFQSRQLPSGHVQHGMGQSQLSQGNQLNRHLSQFSGGANNALFNAAQGTPSTQMISNMSATMPSQSLLPRMQLGLAGNPQRSHLLSDQMFNMGAANPGGMMPMQQQQQQHGSQGAFGNMQPNAQNLQPGMVALQNATQNHPNFQQQRQQNQQ
Length558
PositionHead
OrganismVitis vinifera (Grape)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> Vitales> Vitaceae> Viteae> Vitis.
Aromaticity0.04
Grand average of hydropathy-0.658
Instability index58.43
Isoelectric point9.35
Molecular weight61539.92
Publications
PubMed=17721507

Function

Annotated function 
GO - Cellular Component
mediator complex	GO:0016592	IEA:EnsemblPlants

GO - Biological Function
GO - Biological Process
defense response to fungus	GO:0050832	IEA:EnsemblPlants
regulation of flower development	GO:0009909	IEA:EnsemblPlants









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP26294
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      46.31|      11|     319|       8|      18|       2
---------------------------------------------------------------------------
    8-   18 (23.25/ 7.02)	QDQSQQQQQQQ
  324-  334 (23.06/ 6.89)	QTQHQQQQQQQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      72.29|      22|      22|     391|     412|       3
---------------------------------------------------------------------------
  391-  412 (43.51/14.37)	LPGQQQMQFSQ.TMGHQQFQSRQ
  509-  531 (28.78/ 7.08)	MQQQQQQHGSQgAFGNMQPNAQN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      51.88|      16|      31|      56|      71|       4
---------------------------------------------------------------------------
   56-   71 (27.71/22.28)	ILEDIDAVARANAV.PK
   89-  105 (24.18/18.57)	IMEDIKKVSKAFVVhPK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      61.96|      20|      31|     454|     475|       5
---------------------------------------------------------------------------
  454-  475 (29.79/20.48)	GTP......STQMIsNMSATMPSqSLLP
  483-  508 (32.17/13.88)	GNPqrshllSDQMF.NMGAANPG.GMMP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      48.29|      12|      57|     248|     259|       6
---------------------------------------------------------------------------
  248-  259 (24.11/15.24)	SDASGMYMKNTP
  308-  319 (24.18/15.31)	SPRSGTNMMNTP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      52.53|      15|      36|     374|     388|       7
---------------------------------------------------------------------------
  374-  388 (26.34/12.03)	LPQLHDLQGQAQQKF
  413-  427 (26.19/11.92)	LPSGHVQHGMGQSQL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     112.12|      31|      31|     163|     193|       8
---------------------------------------------------------------------------
  122-  152 (22.74/11.96)	.......KLLPEMETDDNFKK..EQllhGmqnlPISVQIE
  163-  193 (56.56/40.89)	AACESAEKVLAETRKAYCFGT..RQ...G....PTMVPID
  198-  222 (32.82/20.58)	AKIQEQEN.L..LRAAVNFGEvlR............IPLD
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP26294 with Med8 domain of Kingdom Viridiplantae


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) GAQLIGRSAASPSGPTGATSFDNTTTSPLPYANSPRSGTNMMNTPSPQQQTQHQQQQQQQQQQQQQQRQKLMQHMSPHQQQLLAQQIRQSSMPGLGQNQLPQLHDLQGQAQQKFQPLPGQQQMQFSQTMGHQQFQSRQLPSGHVQHGMGQSQLSQGNQLNRHLSQFSGGANNALFNAAQGTPSTQMISNMSATMPSQSLLPRMQLGLAGNPQRSHLLSDQMFNMGAANPGGMMPMQQQQQQHGSQGAFGNMQPNAQNLQPGMVALQNATQNHPNFQQQRQQNQQ
2) MAAMEGIQDQSQQQQQQQAAPPKPAVERLNP
275
1
558
31










Molecular Recognition Features






MoRF SequenceStartStop




NANANA