<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26288

Description Uncharacterized protein
SequenceMRPPLTGGRGGGGFRGGRDGGGRGFGGGRSFGGGRGDRGRGPPRGRGRGAPRGRGGPPRGGMKGGSKVLVEPHRHAGVFIAKGKEDALVTKNLVPGEAVYNEKRISVQNEDGTKIEYRVWNPFRSKLAAAILGGVDNIWIKPGAKVLYLGAASGTTVSHVSDLVGPEGCVYAVEFSHRSGRDLVNMAKKRTNVIPIIEDARHPAKYRMLVGMVDVIFSDVAQPDQARILGLNASFFLKTGGHFVISIKANCIDSTVAAEAVFQSEVKKLQQEQFKPAEQVTLEPFERDHACVVGGYRMPKKQKAPAT
Length307
PositionUnknown
OrganismArabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> malvids> Brassicales> Brassicaceae> Camelineae> Arabidopsis.
Aromaticity0.07
Grand average of hydropathy-0.394
Instability index35.29
Isoelectric point10.15
Molecular weight32750.12
Publications
PubMed=21478890

Function

Annotated function
GO - Cellular Component
nucleolus	GO:0005730	IEA:EnsemblPlants
GO - Biological Function
methyltransferase activity	GO:0008168	IEA:UniProtKB-KW
mRNA binding	GO:0003729	IEA:EnsemblPlants
GO - Biological Process
methylation	GO:0032259	IEA:UniProtKB-KW
rRNA processing	GO:0006364	IEA:InterPro

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP26288
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      68.49|      17|      17|       7|      23|       1
---------------------------------------------------------------------------
    7-   23 (38.44/14.04)	GGRGGGGFRGGRDGG...GR
   27-   46 (30.05/ 9.40)	GGRSFGGGRGDRGRGpprGR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      52.91|      16|      17|     196|     212|       2
---------------------------------------------------------------------------
  196-  212 (25.67/20.65)	IIEDARHPAKYRMLvGM
  216-  231 (27.24/16.79)	IFSDVAQPDQARIL.GL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     186.94|      58|     159|      74|     134|       4
---------------------------------------------------------------------------
   74-  134 (88.60/77.76)	RHAGVFIAKGKEDALvtKNLVPGEAVYNEKRISVQNEDGTKIEYRVWNPFRsKLAAAILGG
  238-  295 (98.35/74.21)	KTGGHFVISIKANCI..DSTVAAEAVFQSEVKKLQQEQFKPAEQVTLEPFE.RDHACVVGG
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP26288 with Med36 domain of Kingdom Viridiplantae

Unable to open file!