<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26280
Description |
Uncharacterized protein |
Sequence | MEMKILEALNFYLVVFHPYRSLPEFSQDSEIYDTSMTHLTWGLVNDTYRMDLILIHPPFLITLACIYIASVHKEKDIRTWFEELFLDMNIVKNIAMEILDFYENHRLFTEERVHAAFNKLATNP |
Length | 124 |
Position | Kinase |
Organism | Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> malvids> Brassicales> Brassicaceae> Camelineae> Arabidopsis.
|
Aromaticity | 0.14 |
Grand average of hydropathy | 0.029 |
Instability index | 47.66 |
Isoelectric point | 5.08 |
Molecular weight | 14802.97 |
Publications | PubMed=21478890
|
Function
Annotated function |
|
GO - Cellular Component | integral component of membrane GO:0016021 IEA:UniProtKB-KW
|
GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP26280
No repeats found
|