<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26279
| Description |
Predicted protein (Fragment) |
| Sequence | MVAATDCPNKFKSRGDKIAELLFSCRVSRCIGCDHLELSIHGDDEANRGRGTTGDGGGGTAVDEDYEVGGSKESKANIRLLVIYTFDEAHALSDEIEELSVVSKDVASIKEILLNKEDDPNSVLLDSLRHLKLMSLNVDILKVGFLVDS |
| Length | 149 |
| Position | Unknown |
| Organism | Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> malvids> Brassicales> Brassicaceae> Camelineae> Arabidopsis.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.185 |
| Instability index | 36.60 |
| Isoelectric point | 4.71 |
| Molecular weight | 16152.01 |
| Publications | PubMed=21478890
|
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP26279
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 60.34| 19| 20| 109| 127| 2
---------------------------------------------------------------------------
109- 127 (30.35/20.44) IKEILLNKEDDPNSVLLDS
131- 149 (29.99/20.13) LKLMSLNVDILKVGFLVDS
---------------------------------------------------------------------------
|