<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26270

Description Mediator of RNA polymerase II transcription subunit 4
SequenceMLQHQIVQSPARLGLTGPGSPSVQNPTPTRHGHPTSSSSSQSQHQQIQQQPNLLPSSTVAAASSASAASAISSSALLSLLPPLPRAQALLQQMAVLTSKLFDVSPNRALWLSAFRGSLPSFLSSHSLPPPPPLENPNPSSTKEILSQFNSLQTQLFEAVTELQEILDLQDAKQKVAREIKSRDSSLLAFANKLKDAERVLDMLVEDYSDYRKPKRSKIVSEEEEDNDNESSSSSTTVSSQLKLKDILAYAHKISYTTFAPPEFGAGQAPLRGALPPAPQDEQMRASQLYAFADLDIGLPKTVENMEKKVEALIEPPPPPPEAMDISAIHNLLPPNIAVPSGWKPGMPVELPRDLPLPPPGWKPGDPVVLPPLESIAAPRAEDQQHMRPPQGLHRPPDVIQVRAVQLDILEDDDSSDYSSDDASSDDED
Length428
PositionMiddle
OrganismArabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> malvids> Brassicales> Brassicaceae> Camelineae> Arabidopsis.
Aromaticity0.04
Grand average of hydropathy-0.479
Instability index72.19
Isoelectric point4.89
Molecular weight46391.57
Publications
PubMed=21478890

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. 
ECO:0000256	RuleBase:RU364141
GO - Cellular Component
mediator complex	GO:0016592	IEA:EnsemblPlants
GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro
GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro

Interaction

Binary Interactions











Repeat regions





Repeats

>MDP26270
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     122.51|      33|      39|     273|     310|       1
---------------------------------------------------------------------------
   80-  125 (30.45/ 8.46)	.L..PPLPRAqallQQMAvlTSKLFDV.SPNRAlwlsafrgsLPSFLSS.....H
  273-  310 (50.65/25.68)	AL..PPAPQD....EQMR..ASQLYAFADLDIG.........LPKTVENmekkvE
  311-  339 (41.41/12.90)	ALiePPPPPP....EAMD..ISAIHNLLPPNIA.........VP...........
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      74.44|      12|     226|     127|     138|       2
---------------------------------------------------------------------------
  127-  138 (28.53/10.34)	LPPPPPLENP.NP
  354-  366 (23.04/ 7.00)	LPLPPPGWKPgDP
  386-  396 (22.87/ 6.89)	MRPPQGLHRP..P
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      96.90|      31|      39|       3|      38|       3
---------------------------------------------------------------------------
    3-   38 (49.08/34.28)	QH.QIVQSPARLgltgPGSpSVQNPTPTRHGHPTSSS
   43-   74 (47.83/21.53)	QHqQIQQQPNLL....PSS.TVAAASSASAASAISSS
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP26270 with Med4 domain of Kingdom Viridiplantae


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) PSGWKPGMPVELPRDLPLPPPGWKPGDPVVLPPLESIAAPRAEDQQHMRPPQGLHRPPDVIQVRAVQLDILEDDDSSDYSSDDASSDDED
2) VQSPARLGLTGPGSPSVQNPTPTRHGHPTSSSSSQSQHQQIQQQPNLLPSSTV
339
7
428
59










Molecular Recognition Features






MoRF SequenceStartStop




1) QGLHRPPDVIQVRAVQLDILEDDDSSDYSSDDA
390
422