<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26269

Description HSC70-1
SequenceMSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNPVNTVFDAKRLIGRRFSDSSVQSDMKLWPFKIQPGPADKPMIYVEYKGEEKMFAAEEISSMVLIKMREIAEAYLGVSIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGIDFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQGAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTTLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTIQDEKIGEKLPAADKKKIEDSIEQAIQWLEGNQLAEADEFEDKMKELESICNPIIAKMYQGAGGEAGPGASGMDDDAPPASGGAGPKIEEVD
Length650
PositionUnknown
OrganismArabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> malvids> Brassicales> Brassicaceae> Camelineae> Arabidopsis.
Aromaticity0.06
Grand average of hydropathy-0.429
Instability index36.32
Isoelectric point5.05
Molecular weight71297.96
Publications
PubMed=21478890

Function

Annotated function 
GO - Cellular Component
apoplast	GO:0048046	IEA:EnsemblPlants
cell wall	GO:0005618	IEA:EnsemblPlants
chloroplast	GO:0009507	IEA:EnsemblPlants
cytosolic ribosome	GO:0022626	IEA:EnsemblPlants
Golgi apparatus	GO:0005794	IEA:EnsemblPlants
nucleolus	GO:0005730	IEA:EnsemblPlants
plasma membrane	GO:0005886	IEA:EnsemblPlants
plasmodesma	GO:0009506	IEA:EnsemblPlants
vacuolar membrane	GO:0005774	IEA:EnsemblPlants

GO - Biological Function
ATP binding	GO:0005524	IEA:UniProtKB-KW
ATPase activity	GO:0016887	IEA:InterPro
mRNA binding	GO:0003729	IEA:EnsemblPlants
protease binding	GO:0002020	IEA:EnsemblPlants

GO - Biological Process
defense response to bacterium	GO:0042742	IEA:EnsemblPlants
defense response to fungus	GO:0050832	IEA:EnsemblPlants
heat acclimation	GO:0010286	IEA:EnsemblPlants
negative regulation of seed germination	GO:0010187	IEA:EnsemblPlants
response to cadmium ion	GO:0046686	IEA:EnsemblPlants
response to cold	GO:0009409	IEA:EnsemblPlants
response to virus	GO:0009615	IEA:EnsemblPlants
stomatal closure	GO:0090332	IEA:EnsemblPlants









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP26269
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      75.81|      18|      21|      38|      55|       1
---------------------------------------------------------------------------
   16-   33 (19.07/10.00)	....TTYSCVGVWQHDRveIIA
   38-   55 (32.55/21.80)	NR..TTPSYVAFTDSER..LIG
   60-   78 (24.19/14.48)	NQvaMNPVNTVF.DAKR..LIG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      65.29|      23|      26|     535|     560|       2
---------------------------------------------------------------------------
  535-  560 (33.05/26.51)	DEEHKKKVEA..KNALENyayNMRNTIQ
  561-  585 (32.24/17.27)	DEKIGEKLPAadKKKIED...SIEQAIQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      73.01|      23|      26|     458|     482|       4
---------------------------------------------------------------------------
  458-  482 (36.09/23.62)	DNNllGKFELSGIPPAPRGVPQITV
  487-  509 (36.91/18.86)	DAN..GILNVSAEDKTTGQKNKITI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      88.95|      29|     189|     170|     200|       5
---------------------------------------------------------------------------
  170-  200 (41.67/35.30)	GLNVMRIINePTaAAIAYGLD.KKATSVGEKN
  362-  391 (47.28/30.30)	GKELCKSIN.PD.EAVAYGAAvQGAILSGEGN
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP26269 with Med37 domain of Kingdom Viridiplantae


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) KDEIEKMVQEAEKYKSEDEEHKKKVEAKNA
2) MYQGAGGEAGPGASGMDDDAPPASGGAGPKIEEVD
518
616
547
650










Molecular Recognition Features






MoRF SequenceStartStop




1) PKIEEVD
644
650