<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26257
| Description |
Uncharacterized protein |
| Sequence | MESESVKFGGPRELGGALDLVTQYKLLPHHEFFCKRSLPESLSDAHYLHNLVGDTEIRKGDGMQLDQLIPNASLSSRDSNARIQPFVLDELKEAFELNDTAPVELPPAEKGAPTTASKSKSESKDKDRKHRKHKEKNKEKDREHKKHKHKHKDRSKDKDKDKDRDRKKDKSGHHDKKRKYNGTEDLDDVQRHKKSKHKSSRLDEMGAM |
| Length | 208 |
| Position | Head |
| Organism | Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> malvids> Brassicales> Brassicaceae> Camelineae> Arabidopsis.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -1.514 |
| Instability index | 42.76 |
| Isoelectric point | 9.37 |
| Molecular weight | 23988.61 |
| Publications | PubMed=21478890
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP26257
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 77.15| 21| 21| 134| 154| 1
---------------------------------------------------------------------------
134- 154 (40.48/16.55) KEKNKEKDREHKKHKHKHKDR
156- 176 (36.67/14.35) KDKDKDKDRDRKKDKSGHHDK
---------------------------------------------------------------------------
|