<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26252

Description Uncharacterized protein
SequenceMETQPQQPPPPVAEKLNPKLEKELNLESLKTRAVSLVKAVSRILEDFDAYGRTNTTPKWQDILGQYSMVNLELFNIVEEVKKVSNAFVVLPKNVNAMNAGILPVMLSSKLLPEMETDDNAKREQLLQGVQSLPIPMQIERLKARMDMIAAACENAEKVLADTRKAYGFGTRQGPSMLPTMDKGQAAKIQEQESMLRAAVNDGAGTKLPPDQRQITTALPPHLADVLIINDAGKIALPGQLNNINNQGMMQVSGTQFMGRSAASPSGPNFDNTTSPLPYSNSPRATGMVNAPSPQQQIQQQLQQQQQRSKLMQLPQHQQQLLAQQQQQLRQSSMQGLGQSQIPALHDMHGQAQQKFQTLHGQHQMPYSQPMAAHQQFQARQLSGGHIQHSMSQGQLNPAMNRHLNQFSGGANSALFTSAQGSPSSQMIPNMSSMQSQTLVPRMQQFGVSGTNPQRSHSSQMLGDQMFNSSGMMQTQQPQQQQQQQQQQGGYGNMQTNLQPNNMMQNAQQRHQNPQ
Length514
PositionHead
OrganismArabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> malvids> Brassicales> Brassicaceae> Camelineae> Arabidopsis.
Aromaticity0.04
Grand average of hydropathy-0.723
Instability index57.69
Isoelectric point9.40
Molecular weight56829.72
Publications
PubMed=21478890

Function

Annotated function 
GO - Cellular Component
mediator complex	GO:0016592	IEA:EnsemblPlants

GO - Biological Function
GO - Biological Process
defense response to fungus	GO:0050832	IEA:EnsemblPlants
regulation of flower development	GO:0009909	IEA:EnsemblPlants









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP26252
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      58.03|      16|      20|     291|     310|       1
---------------------------------------------------------------------------
  291-  306 (32.32/ 6.78)	PSPQQQIQQQLQQQQQ
  314-  329 (25.71/ 6.58)	PQHQQQLLAQQQQQLR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      53.46|      17|      22|     336|     356|       3
---------------------------------------------------------------------------
  336-  354 (26.30/10.30)	L.GQSQIPALHDMhgQAQQK
  358-  375 (27.16/ 8.68)	LhGQHQMPYSQPM..AAHQQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      46.73|      14|      60|     433|     453|       4
---------------------------------------------------------------------------
  433-  448 (20.48/ 8.04)	MQSQTLVPRMqqFGVS
  456-  469 (26.25/ 8.00)	HSSQMLGDQM..FNSS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     185.98|      46|      60|     174|     219|       5
---------------------------------------------------------------------------
  108-  173 (49.14/24.88)	SKLLPEMETDDNAKreqllqgvqslpipmqierLKARMDMIAAACEN......AEKVL.........ADTRKaygFGTRQG
  174-  219 (77.21/43.03)	PSMLPTMDKGQAAK...................IQEQESMLRAAVNDG....AGTKLP.........PDQRQ...ITTALP
  220-  277 (59.63/31.67)	PHLADVLIINDAGK...................I.ALPGQLNNINNQGmmqvSGTQFMgrsaaspsgPNFDN...TTSPLP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      65.61|      18|      23|     380|     397|       6
---------------------------------------------------------------------------
  380-  397 (33.93/17.07)	QLSGGHIQHSMSQGQLNP
  405-  422 (31.68/15.48)	QFSGGANSALFTSAQGSP
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP26252 with Med8 domain of Kingdom Viridiplantae


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) PGQLNNINNQGMMQVSGTQFMGRSAASPSGPNFDNTTSPLPYSNSPRATGMVNAPSPQQQIQQQLQQQQQRSKLMQLPQHQQQLLAQQQQQLRQSSMQGLGQSQIPALHDMHGQAQQKFQTLHGQHQMPYSQPMAAHQQFQARQLSGGHIQHSMSQGQLNPAMNRHLNQFSGGANSALFTSAQGSPSSQMIPNMSSMQSQTLVPRMQQFGVSGTNPQRSHSSQMLGDQMFNSSGMMQTQQPQQQQQQQQQQGGYGNMQTNLQPNNMMQNAQQRHQNPQ
2) TRQGPSMLPTMDKGQAAKIQEQESMLRAAVNDGAGTKLPPDQRQITTALPP
237
170
514
220










Molecular Recognition Features






MoRF SequenceStartStop




NANANA