<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26239
Description |
Uncharacterized protein |
Sequence | MDPQTQNTSLPRVQNVEKGVSDLELGEGVMEKLVSPSGEDMNSRAQLNVKDNRKNVTTGVTSFDSRITFYSVATLVVITILVGSIFVLWFDTRNIGTLHKLLYVFLSAATIPYIGLLFICLCNDVPVPSYRLGAEGRFGIYLATMVVIYCISYCIEDFDVMMEVSFLAIMSISGAVAIVQLHSPAEDLNSSRTTFILVLGTMSAILGCVAKDSWMSLSGSLCFFMVVMCLIKINCLAADHFEEQQRERRRRRHRHPDCSKDVGE |
Length | 264 |
Position | Head |
Organism | Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> malvids> Brassicales> Brassicaceae> Camelineae> Arabidopsis.
|
Aromaticity | 0.08 |
Grand average of hydropathy | 0.295 |
Instability index | 47.73 |
Isoelectric point | 5.76 |
Molecular weight | 29371.88 |
Publications | PubMed=21478890
|
Function
Annotated function |
|
GO - Cellular Component | integral component of membrane GO:0016021 IEA:UniProtKB-KW
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP26239
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 45.81| 14| 68| 64| 78| 2
---------------------------------------------------------------------------
64- 78 (20.05/18.91) DSRITFYsVATLVVI
135- 148 (25.77/18.60) EGRFGIY.LATMVVI
---------------------------------------------------------------------------
|