<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26230

Description Predicted protein
SequenceMTLIVKFVVEQHCSFHSDNRSQLKFVNGGDKRRSNCWKLFGIGSHLPEVNKSRGHFLQTNWSKHAKAFECIPSLNKFMGSNFLYSLESQKLARDREMGARSIENIAPVTVQTLARPEIEKAWCTLINLSINNTYLRPGITPAIDDGSTDRSSSTKRSTVKVTSSADGSFYAHNHPEHSQRSLRGTAKSFDSFSSSSVGDNNITIGKVPRVNDEVRDSVTGCKYTNGMEMPPIKNSAHLVRLVEPREASLGEIDYDDIMEIIEVDQIVMDHCPSRCPKQPSVSKFVDTFASRREEEQGLFPELCSNCSHGIKLGLCPEASTHVEQMKDTLLAISNEFLDNTYDLGPDHVEQLRQKRLLLKKQIQQLEILIQNKERKKSECLVSTPSHNIQYETPQTTNHVVVYTQTDSPDKSCGGLCPATEGRYVTDNWNMPRDYLVSKERYDISSGSVEREQSVSEVIDVTDTESSNDKKWASRDFPWTKNLEVYNKIVFGNHSFRPNQREIINATMSGCDVFVLMPTGGGKSLTYQLPALLCAGITLVISPLVSLIQDQIMNLLQTNISAASLSAGMEWAEQLEILQELSSENSKYKLLYVTPEKVAKSESLIRHLEILNSRSLLARFVIDEAHCVSQWGHDFRPDYQGLGVLKQKFPNIPMLALTATATTSVKEDVVQALGLVNCVVFRQSFNRPNLWYSVVPKTNKCLEDIDKFIRENHFDECGIIYCLSRMDCEKVTEMLRAFGHKAAFYHGSMDPGKRAFVQKQWSKDEINIICATVAFGMGINKPDVRFVIHHSLPKSIEGYHQECGRAGRDGQRSSCVLYYSYTDYIRVKHMISQGGLGQGQMKMGYNCKASSGRMLETNTENLLRMVSYCENEVDCRRFLQLVHLGEKFDSTNCKKTCDNCSSSKILIDKDVTVIARQLVELVKLTGERFSSAHIVEIYRGSLNQSVKRNRQETLHLHGAGKHLTKSEASRILHYLVTEDILAEGVRKSDLYGSVSSLLKVNRSKAASLLSGGQSITMRFPSTIKASKPSKSTAKVPLKQTTLPMAKAAPQDSNLPHILLTALKKLRSDIVKESSDGVMAYHIFGKATLEQISKRLPRTKEELLDINGLGKAKVSKYGDRLLETIYSTINDHYKTGPGSGKRRRDENICPNVADDDDPDWTASQSHKKAVKNKK
Length1172
PositionUnknown
OrganismArabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> malvids> Brassicales> Brassicaceae> Camelineae> Arabidopsis.
Aromaticity0.07
Grand average of hydropathy-0.447
Instability index50.58
Isoelectric point8.66
Molecular weight131537.39
Publications
PubMed=21478890

Function

Annotated function 
GO - Cellular Component
GO - Biological Function
3'-5' DNA helicase activity	GO:0043138	IEA:InterPro
ATP binding	GO:0005524	IEA:UniProtKB-KW
hydrolase activity	GO:0016787	IEA:UniProtKB-KW
nucleic acid binding	GO:0003676	IEA:InterPro

GO - Biological Process
DNA recombination	GO:0006310	IEA:InterPro
DNA repair	GO:0006281	IEA:InterPro
DNA replication	GO:0006260	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP26230
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      50.12|      16|      21|      78|      96|       1
---------------------------------------------------------------------------
   78-   93 (27.68/22.77)	MGSNFLYSLES...QKLAR
   97-  115 (22.44/ 8.29)	MGARSIENIAPvtvQTLAR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      71.43|      22|     206|     363|     384|       3
---------------------------------------------------------------------------
  363-  384 (38.23/30.62)	QQLEILIQ.NKERKKSECLVSTP
  572-  594 (33.20/25.42)	EQLEILQElSSENSKYKLLYVTP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      35.71|      10|      23|     321|     330|       4
---------------------------------------------------------------------------
  321-  330 (18.00/14.65)	HVEQMKDTLL
  347-  356 (17.70/14.26)	HVEQLRQKRL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      43.66|      12|      28|     893|     904|       5
---------------------------------------------------------------------------
  893-  904 (22.66/13.50)	KKTCDNCSSSKI
  922-  933 (20.99/11.94)	KLTGERFSSAHI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      60.26|      16|      22|     713|     729|       8
---------------------------------------------------------------------------
  713-  729 (28.28/25.68)	FDECGIIYCLSrMDCEK
  737-  752 (31.99/23.14)	FGHKAAFYHGS.MDPGK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      60.15|      17|      17|     422|     438|       9
---------------------------------------------------------------------------
  422-  438 (32.27/23.27)	RYVTDNWNMPRDYLVSK
  440-  456 (27.87/19.03)	RYDISSGSVEREQSVSE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      44.03|      14|      17|     476|     491|      10
---------------------------------------------------------------------------
  476-  491 (22.64/20.46)	F.PWTKnlEVYNKIVFG
  495-  509 (21.39/12.03)	FrPNQR..EIINATMSG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      57.19|      17|      21|     196|     212|      11
---------------------------------------------------------------------------
  196-  212 (29.33/19.14)	SVGDNNITIG.KVPRVND
  217-  234 (27.85/17.79)	SVTGCKYTNGmEMPPIKN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      80.88|      24|      28|     786|     810|      12
---------------------------------------------------------------------------
  786-  810 (40.93/32.85)	VIHHSLPKSIEGYHQ.ECGRAGRdGQ
  815-  839 (39.95/26.49)	VLYYSYTDYIRVKHMiSQGGLGQ.GQ
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP26230 with Med34 domain of Kingdom Viridiplantae


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) HYKTGPGSGKRRRDENICPNVADDDDPDWTASQSHKKAVKNKK
1130
1172










Molecular Recognition Features






MoRF SequenceStartStop




1) DENICPN
2) DWTASQSHKKAVKNKK
1143
1157
1149
1172