<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26226
| Description |
Mediator of RNA polymerase II transcription subunit 10 |
| Sequence | MEEGRQKDLQLLEEIIDKGLKQKLVHATASRSDLRKNLETLEKNAVNSLKTMVNLGSEVYMQAEVPDTQHIFMDVGLGFYVEFTRQEALDYIAQKEERTKKQLEEYTGVITQIKGRIKLENLIRPEHLYLSLAKPISVLVMDPAQNTSAGIGGSGSNGTIRYQTNDGTSTVADDSKENLSQVINSIEKTLGVLHQLHLTVTSFTPASQLHLLQRLNSLVMELDNMTKLSEKCNIQVPMEVLNLIDDGKNPDEFTKDVLNSCIARNQVTKGKTDAFKDLRKHILEELEQTFPDEVDMYREIRASSAAVSC |
| Length | 309 |
| Position | Middle |
| Organism | Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> malvids> Brassicales> Brassicaceae> Camelineae> Arabidopsis.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.427 |
| Instability index | 33.67 |
| Isoelectric point | 5.31 |
| Molecular weight | 34723.11 |
| Publications | PubMed=21478890
|
Function
| Annotated function |
Binds specifically to cytosolic chaperonin (c-CPN) and
transfers target proteins to it. Binds to nascent polypeptide chain and
promotes folding in an environment in which there are many competing
pathways for nonnative proteins.
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP26226
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 124.73| 42| 242| 1| 43| 2
---------------------------------------------------------------------------
1- 43 (62.93/48.40) MEEGRQKDlQLLEEIIDKGLKQKLVH..ATASRSDLRKN.LETLEK
244- 288 (61.80/42.75) IDDGKNPD.EFTKDVLNSCIARNQVTkgKTDAFKDLRKHiLEELEQ
---------------------------------------------------------------------------
|