| Description | Surfeit locus protein 5 family protein |
| Sequence | MNKGGGSGGGSGPTAAAAAAALQKQKALMQRVETDITSVVDNFTQIVNVARVSDPPMKNSQEAYMMEMRASRLVQAADSLLKLVSELKQTAIFSGFASLNDHVEQRTAEFDKEAEKTNRLLARIADDASASLKELESHYYSSAQRLTLDI |
| Length | 150 |
| Position | Head |
| Organism | Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> malvids> Brassicales> Brassicaceae> Camelineae> Arabidopsis. |
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.335 |
| Instability index | 28.89 |
| Isoelectric point | 5.70 |
| Molecular weight | 16194.06 |
| Publications | PubMed=21478890 |
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:EnsemblPlants |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats | >MDP26215 No repeats found |
| MoRF Sequence | Start | Stop |
| 1) AAAAAAAL 2) RLLARIA | 15 119 | 22 125 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab