Description | Surfeit locus protein 5 family protein |
Sequence | MNKGGGSGGGSGPTAAAAAAALQKQKALMQRVETDITSVVDNFTQIVNVARVSDPPMKNSQEAYMMEMRASRLVQAADSLLKLVSELKQTAIFSGFASLNDHVEQRTAEFDKEAEKTNRLLARIADDASASLKELESHYYSSAQRLTLDI |
Length | 150 |
Position | Head |
Organism | Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> malvids> Brassicales> Brassicaceae> Camelineae> Arabidopsis. |
Aromaticity | 0.05 |
Grand average of hydropathy | -0.335 |
Instability index | 28.89 |
Isoelectric point | 5.70 |
Molecular weight | 16194.06 |
Publications | PubMed=21478890 |
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:EnsemblPlants |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP26215 No repeats found |
MoRF Sequence | Start | Stop |
1) AAAAAAAL 2) RLLARIA | 15 119 | 22 125 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab