Description | Mediator of RNA polymerase II transcription subunit 22-like Protein |
Sequence | MSVPRALPQSKEALLKSYRTRLKDDVKSMLENFEEIVKLAKGDHDTQLSRMTQCEQDTFEMHVRAANIVRAGESLMKLVSDIKQYLILNDFPSVNEAITQNSKLFRTKQAECDQKLMSLRDDMAADLYDLEEEYYSSLNK |
Length | 140 |
Position | Head |
Organism | Tribolium castaneum (Red flour beetle) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota> Neoptera> Endopterygota> Coleoptera> Polyphaga> Cucujiformia> Tenebrionidae> Tenebrionidae incertae sedis> Tribolium. |
Aromaticity | 0.06 |
Grand average of hydropathy | -0.601 |
Instability index | 49.34 |
Isoelectric point | 5.26 |
Molecular weight | 16200.29 |
Publications | PubMed=18362917 PubMed=19820115 |
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP26202 No repeats found |
MoRF Sequence | Start | Stop |
1) DLYDLEEEYY 2) LLKSYRTRLKD | 126 14 | 135 24 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab