| Description | Mediator of RNA polymerase II transcription subunit 22-like Protein |
| Sequence | MSVPRALPQSKEALLKSYRTRLKDDVKSMLENFEEIVKLAKGDHDTQLSRMTQCEQDTFEMHVRAANIVRAGESLMKLVSDIKQYLILNDFPSVNEAITQNSKLFRTKQAECDQKLMSLRDDMAADLYDLEEEYYSSLNK |
| Length | 140 |
| Position | Head |
| Organism | Tribolium castaneum (Red flour beetle) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota> Neoptera> Endopterygota> Coleoptera> Polyphaga> Cucujiformia> Tenebrionidae> Tenebrionidae incertae sedis> Tribolium. |
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.601 |
| Instability index | 49.34 |
| Isoelectric point | 5.26 |
| Molecular weight | 16200.29 |
| Publications | PubMed=18362917 PubMed=19820115 |
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats | >MDP26202 No repeats found |
| MoRF Sequence | Start | Stop |
| 1) DLYDLEEEYY 2) LLKSYRTRLKD | 126 14 | 135 24 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab