| Description | Mediator of RNA polymerase II transcription subunit 9 |
| Sequence | MMESDEHNQESERNVTVENLNIEILPIIYEIIRSVEKDHHDNTAKARESQDCSQKVLELQKRLDQARAEIRLLPGIEYSKEQQLDHLEALKTQLKLKQELLRKYRYILSESYPMRKAAQVVVRAVYHGKNLIEERGLDKRLSPEEFRALMKRIAQNLQGQIKQASDEFKHKMK |
| Length | 173 |
| Position | Middle |
| Organism | Tribolium castaneum (Red flour beetle) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota> Neoptera> Endopterygota> Coleoptera> Polyphaga> Cucujiformia> Tenebrionidae> Tenebrionidae incertae sedis> Tribolium. |
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.858 |
| Instability index | 59.83 |
| Isoelectric point | 8.55 |
| Molecular weight | 20450.21 |
| Publications | PubMed=18362917 PubMed=19820115 |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364145 |
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP26200
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 52.38| 16| 21| 135| 151| 1
---------------------------------------------------------------------------
135- 151 (23.21/18.44) RGLDKRLSpEEFRALMK
158- 173 (29.17/17.60) QGQIKQAS.DEFKHKMK
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) FKHKMK 2) LRKYRYIL | 168 101 | 173 108 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab