Description | Mediator of RNA polymerase II transcription subunit 9 |
Sequence | MMESDEHNQESERNVTVENLNIEILPIIYEIIRSVEKDHHDNTAKARESQDCSQKVLELQKRLDQARAEIRLLPGIEYSKEQQLDHLEALKTQLKLKQELLRKYRYILSESYPMRKAAQVVVRAVYHGKNLIEERGLDKRLSPEEFRALMKRIAQNLQGQIKQASDEFKHKMK |
Length | 173 |
Position | Middle |
Organism | Tribolium castaneum (Red flour beetle) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota> Neoptera> Endopterygota> Coleoptera> Polyphaga> Cucujiformia> Tenebrionidae> Tenebrionidae incertae sedis> Tribolium. |
Aromaticity | 0.05 |
Grand average of hydropathy | -0.858 |
Instability index | 59.83 |
Isoelectric point | 8.55 |
Molecular weight | 20450.21 |
Publications | PubMed=18362917 PubMed=19820115 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364145 |
GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP26200 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 52.38| 16| 21| 135| 151| 1 --------------------------------------------------------------------------- 135- 151 (23.21/18.44) RGLDKRLSpEEFRALMK 158- 173 (29.17/17.60) QGQIKQAS.DEFKHKMK --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) FKHKMK 2) LRKYRYIL | 168 101 | 173 108 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab