<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26198
| Description |
Mediator of RNA polymerase II transcription subunit 30-like Protein |
| Sequence | MSAPQHHFMQGLNNSQQTALRNQFASTMQSQMGTTMQNQLPVHMGNQMNNPMMSQMASTLNNPTMPNSQIMGQLNQQYAMNPANQIAQHQGGNMQMQQGSMEFSNNLQHHAMQANQAQMVQQGGAVAPAPQIQAQQQQQQQSKEFNTASLCRIGQETVQDIVSRTQEVFQTLKTIQPPNGTPQSSNASNEKKAKVQEQLRTIRVLFKRLRLIYEKCNENCQLQGMEYTHIESLIPFKDEHDPKHDEKKNSEAYRLACEECKEVMEQVILKNKQLKDVIDHLRRIIWEINTMLTMRRS |
| Length | 297 |
| Position | Head |
| Organism | Tribolium castaneum (Red flour beetle) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Coleoptera> Polyphaga> Cucujiformia>
Tenebrionidae> Tenebrionidae incertae sedis> Tribolium.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.844 |
| Instability index | 54.36 |
| Isoelectric point | 8.57 |
| Molecular weight | 34009.26 |
| Publications | PubMed=18362917
PubMed=19820115
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IBA:GO_Central
|
| GO - Biological Process | positive regulation of transcription, DNA-templated GO:0045893 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP26198
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
4| 141.50| 26| 29| 67| 92| 1
---------------------------------------------------------------------------
29- 46 (31.17/10.35) QSQ.MGTTM.......Q.......NQLPV..HMGN
49- 66 (26.45/ 7.71) NNPMMSQMA.......S..TLNNPTM........P
67- 92 (51.80/21.89) NSQIMGQLN.......QQYAMNPANQIAQ..HQGG
93- 124 (32.08/10.86) NMQ.MQQGSmefsnnlQHHAMQ.ANQ.AQmvQQGG
---------------------------------------------------------------------------
|