<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26189
Description |
Mediator of RNA polymerase II transcription subunit 27-like Protein |
Sequence | MERDIEQLNSALNSIKTLRSNVRRVFESVSNGLRADHGEDGKENKFIHELQELLTTVNNNLRDVESAVGNLTPPPGPFNLGSTAFLGQETTQERQALYGQLVNSYKWTDKVREYSALAGNILQTNSFNKTYKTFSTTKRRKTQTSNHNVSPEVIENLITNIDRLFPDVTITASRPFLPNPVIQACLGRVLKAIIAFKGLMIEWVVVKALSESNDLWAESRYKVFKKVTENCHAAMCHFHSPMMPELAVKSFMHWFHSYNTLFSAPCKRCGNHLLGNLPPTWRDLRTLEPYHEECK |
Length | 295 |
Position | Tail |
Organism | Tribolium castaneum (Red flour beetle) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Coleoptera> Polyphaga> Cucujiformia>
Tenebrionidae> Tenebrionidae incertae sedis> Tribolium.
|
Aromaticity | 0.09 |
Grand average of hydropathy | -0.441 |
Instability index | 53.06 |
Isoelectric point | 8.83 |
Molecular weight | 33625.94 |
Publications | PubMed=18362917
PubMed=19820115
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP26189
No repeats found
|