<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26180
| Description |
Mediator of RNA polymerase II transcription subunit 28-like Protein |
| Sequence | MATPTNGSGNLVDEFEEAFQHCLNVLTKEEAVPNSDKDEMKVEVEQTTLRFIDLARQMEAFFLQKRFLLSALKPEMIVKEDINEYRLELARKDELLKRHYEKIAVWQNLLADLQGYAKSPAQGSATPTLNNGGSVQSPMAGLPGNQTPNPMMVSGMSTTMQQQLQQQQLQQMQQQQQMQQMQQQQIQQLQQQMQVDRR |
| Length | 198 |
| Position | Head |
| Organism | Tribolium castaneum (Red flour beetle) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Coleoptera> Polyphaga> Cucujiformia>
Tenebrionidae> Tenebrionidae incertae sedis> Tribolium.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.731 |
| Instability index | 54.05 |
| Isoelectric point | 5.13 |
| Molecular weight | 22713.58 |
| Publications | PubMed=18362917
PubMed=19820115
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP26180
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 56.89| 14| 15| 162| 175| 1
---------------------------------------------------------------------------
162- 175 (28.37/10.20) QQLQQQQLQQMQQQ
179- 192 (28.51/10.29) QQMQQQQIQQLQQQ
---------------------------------------------------------------------------
|