<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26179
| Description |
Uncharacterized protein |
| Sequence | MREKKDERRSTPALPVYKSQPPVWLPTIHGTADLGYPAFYPPRPGQDEDVLSASNIKNGFLLPQPVSVETFSAQSMINEKLRNNDTLSKLEELMNEVFVRRAERTSPIPPSSFRMPTRVTLNDAKRQAWFADLANPEVPLHKLGKSVPHGAKGHDLLDLLQSHDVAIPRAVWVLRVFGANETAGLRNKPSYNPTQYSIEWANVVTGYLKKQLYEIALPSAPRPGLNIKQTFKGVLSEPESRERWISRFAYSLKLLRTFYREGLVDRKTFLVWLVQQMAICNLAQAGFVTRLVDEYLDDMLTIRALARPLAEACLTKLAEVRGFVTRQICFIT |
| Length | 332 |
| Position | Kinase |
| Organism | Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) (Inky cap fungus) (Hormographiella aspergillata) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Agaricomycetes>
Agaricomycetidae> Agaricales> Psathyrellaceae> Coprinopsis.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.295 |
| Instability index | 51.12 |
| Isoelectric point | 9.49 |
| Molecular weight | 37660.02 |
| Publications | PubMed=20547848
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP26179
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 39.81| 12| 35| 279| 290| 1
---------------------------------------------------------------------------
279- 290 (23.12/16.84) ICNLAQA.GFVTR
314- 326 (16.69/10.40) LTKLAEVrGFVTR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 37.28| 10| 39| 222| 231| 2
---------------------------------------------------------------------------
222- 231 (19.15/12.28) RPGLNIKQTF
260- 269 (18.13/11.30) REGLVDRKTF
---------------------------------------------------------------------------
|