<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26165
Description |
Mediator of RNA polymerase II transcription subunit 7 |
Sequence | MPQEPPPGALSSAFPPPPTYYTHFTEENLTALKSHRLEDGTLPPDDTLPDPLCYLVPPPPPAGSYRAFGEEWMVPERYPSLEEAGIRQLYPPTSMAAVAAANGGGGGGGADKGKELTVDRTVELRRLSKSLLLNYLELVGVMGMAPEQFHEKTADLETILFNMHHLINEYRPHQARETLCLRMEEQLERTRRETEENRKAVAKVEDILAGLELVAKRADAICGGDGLGAGREKKVDDGVAKARVRDVEAWKALVGMGG |
Length | 258 |
Position | Middle |
Organism | Tuber melanosporum (strain Mel28) (Perigord black truffle) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Pezizomycetes>
Pezizales> Tuberaceae> Tuber.
|
Aromaticity | 0.06 |
Grand average of hydropathy | -0.471 |
Instability index | 49.29 |
Isoelectric point | 5.21 |
Molecular weight | 28224.76 |
Publications | PubMed=20348908
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364060
ECO:0000256 ARBA:ARBA00003669
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP26165
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 39.15| 10| 51| 5| 14| 1
---------------------------------------------------------------------------
5- 14 (19.29/ 7.65) PPPGALSSAF
59- 68 (19.86/ 8.06) PPPAGSYRAF
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 144.13| 44| 116| 96| 143| 2
---------------------------------------------------------------------------
96- 143 (65.63/50.52) AAVAAANGGGGGGGAdkGKELTVDRTVELRRLSKslLLNYLELVGVMG
215- 258 (78.50/48.08) AKRADAICGGDGLGA..GREKKVDDGVAKARVRD..VEAWKALVGMGG
---------------------------------------------------------------------------
|