<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26163
| Description |
Uncharacterized protein |
| Sequence | MQRAEDREVDDKDDRGGGRPGLLTSTSTIFNTITPTQHPPSKRKREGTHHEEGDEGEDEQEEDQEERGLHEEIMPPYKSKVRVLEEYHIIGFISSGTYGRVYKARSKLPGNTKEYAIKKFKPDKEGEIIQYTGISQSACREMALCSELSHENVIHLHEIILEDKCIYMVFEYAEHDLLQIVHYHSHPERRPIPEATIKSVLWQLLNGVSYLHQNWVLHRDLKPANIMVTAAGEVKIGDLGLARLFWKPLQSLYAGDKVVVTIWYRAPELLLGSKHYTAAIDLWAVGCIFAELLALRPIFKGEEAKMEKKSTVPFQRNQMQKIIEILGTPNKERWPAVVQQPEYNQLQAFKQYTNNLEAWYHQIGATNALGFQLLSGLLNYDPTQRLTAQSALEHPYFSEGAKLTLNAFEGQSFDYPHRRVSQDDNDISLPGTKRSGLPDDSLGGSRAKRLKEG |
| Length | 453 |
| Position | Kinase |
| Organism | Tuber melanosporum (strain Mel28) (Perigord black truffle) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Pezizomycetes>
Pezizales> Tuberaceae> Tuber.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.604 |
| Instability index | 48.12 |
| Isoelectric point | 6.08 |
| Molecular weight | 51631.79 |
| Publications | PubMed=20348908
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:EnsemblFungi
|
| GO - Biological Function | ATP binding GO:0005524 IEA:InterPro
cyclin-dependent protein serine/threonine kinase activity GO:0004693 IEA:EnsemblFungi
RNA polymerase II CTD heptapeptide repeat kinase activity GO:0008353 IEA:EnsemblFungi
|
| GO - Biological Process | negative regulation of filamentous growth GO:0060258 IEA:EnsemblFungi
negative regulation of transcription by RNA polymerase II GO:0000122 IEA:EnsemblFungi
nuclear-transcribed mRNA catabolic process, non-stop decay GO:0070481 IEA:EnsemblFungi
phosphorylation of RNA polymerase II C-terminal domain GO:0070816 IEA:EnsemblFungi
positive regulation of transcription from RNA polymerase II promoter by galactose GO:0000435 IEA:EnsemblFungi
protein destabilization GO:0031648 IEA:EnsemblFungi
response to oxidative stress GO:0006979 IEA:EnsemblFungi
|
Interaction
Repeat regions
| Repeats |
>MDP26163
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 42.78| 12| 51| 5| 16| 1
---------------------------------------------------------------------------
5- 16 (21.49/13.49) EDREVDDKDDRG
57- 68 (21.28/13.29) EDEQEEDQEERG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 59.89| 17| 73| 267| 283| 3
---------------------------------------------------------------------------
267- 283 (31.65/20.31) PEL..LLGSKHYTAAIDLW
341- 359 (28.24/17.42) PEYnqLQAFKQYTNNLEAW
---------------------------------------------------------------------------
|