<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26143
| Description |
Uncharacterized protein |
| Sequence | MADILTQLQTCLDQLATQFYATLCYLTTYHDHSPAIPPPNVPTAIPQLKKIPKNAPPNTPAAQPASGQAQVQDQKDQTPQQQQQQQQQQGGEGSGGAQDQNKDLPPRPDSPNTFAQRQRELARDLIIKEQQIEYLISVLPGIGSSEAEQEARIRQLADELREAERVRRRKRKQMKKLAERVDDLLEARNGVFEELPKGNPMAAVW |
| Length | 205 |
| Position | Middle |
| Organism | Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) (Trichophyton mentagrophytes) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Onygenales> Arthrodermataceae> Trichophyton.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.908 |
| Instability index | 62.71 |
| Isoelectric point | 6.17 |
| Molecular weight | 22991.57 |
| Publications | PubMed=21247460
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 ARBA:ARBA00003669
ECO:0000256 RuleBase:RU366036
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP26143
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 49.83| 14| 25| 66| 80| 1
---------------------------------------------------------------------------
66- 80 (22.66/13.88) SGQAQVQDqKDQTPQ
94- 107 (27.17/12.69) SGGAQDQN.KDLPPR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 54.68| 13| 16| 34| 46| 2
---------------------------------------------------------------------------
34- 46 (27.47/13.12) PAIPPPNVPTAIP
52- 64 (27.20/12.93) PKNAPPNTPAAQP
---------------------------------------------------------------------------
|