<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26128
Description |
Intersex-like (Drosophila) (Predicted) |
Sequence | MAAPQPQAAAVSSAAGVSGPGSAGGPGPQQQPQPTQLVGAAQSGLLQQQQQDFDPVQRYKMLIPQLKESLQTLMKVAAQNLIQNTNIDNGQKSSDGPIQRFDKCLEEFYALCDQLELCLRLAHECLSQSCDSAKHSPTLVPTATKPDAVQPDSLPYPQYLAVIKAQITCAKDIHTALLDCANKVTGKTTAPSTGPGGSL |
Length | 199 |
Position | Tail |
Organism | Rattus norvegicus (Rat) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Glires> Rodentia> Myomorpha> Muroidea> Muridae>
Murinae> Rattus.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.326 |
Instability index | 61.18 |
Isoelectric point | 5.86 |
Molecular weight | 20964.54 |
Publications | PubMed=15057822
PubMed=15632090
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 ISO:RGD
nucleoplasm GO:0005654 IEA:Ensembl
|
GO - Biological Function | transcription coregulator activity GO:0003712 IBA:GO_Central
transcription factor binding GO:0008134 IBA:GO_Central
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
Repeats |
>MDP26128
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 38.68| 11| 25| 5| 15| 1
---------------------------------------------------------------------------
5- 15 (18.30/ 9.88) QPQAAAVSSAA
31- 41 (20.39/11.85) QPQPTQLVGAA
---------------------------------------------------------------------------
|