<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26119

Description Mediator of RNA polymerase II transcription subunit 19
SequenceMENFTALFGAQTDPPPPPSALGFGPGKPPPPPPPPPGGGPGTAPPSTATSAPVGADKSTAGSGPFYLMRELPGSTELTGSTNLITHYNLEQAYNKFCGKKVKEKLSNFLPDLPGMIDLPGSHDNSSLRSLIEKPPILGGSFNPITGTMLSGFRLHTGPLPEQCRLMHIQPPKKKNKHKHKQSRTQDPVPPETPSDSDHKKKKKKKEEDPERKRKKKEKKKKKNRHSPDHPGMGSSQASSSSSLR
Length244
PositionHead
OrganismRattus norvegicus (Rat)
KingdomMetazoa
LineageEukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Euarchontoglires> Glires> Rodentia> Myomorpha> Muroidea> Muridae> Murinae> Rattus.
Aromaticity0.05
Grand average of hydropathy-1.045
Instability index65.73
Isoelectric point9.88
Molecular weight26320.71
Publications
PubMed=15057822
PubMed=15632090

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. 
GO - Cellular Component
mediator complex	GO:0016592	ISO:RGD

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro
transcription factor binding	GO:0008134	IBA:GO_Central

GO - Biological Process
positive regulation of transcription by RNA polymerase II	GO:0045944	IBA:GO_Central









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP26119
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     127.82|      32|     115|      99|     130|       1
---------------------------------------------------------------------------
   67-   83 (21.56/ 6.17)	..........LMRELPGSTELTGSTN......L
   99-  130 (58.86/26.78)	KKVKEKLSN.FLPDLPGMIDLPGSHDNSSLRSL
  215-  243 (47.40/20.45)	KKEKKKKKNrHSPDHPGM....GSSQASSSSSL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      55.10|      12|      16|      14|      25|       2
---------------------------------------------------------------------------
   14-   25 (27.28/ 9.86)	PPPPPSALGFGP
   33-   44 (27.82/10.21)	PPPPGGGPGTAP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      49.86|      16|      16|     170|     185|       3
---------------------------------------------------------------------------
  170-  185 (28.50/12.49)	PPK...KKNKHKHKQSRTQ
  189-  207 (21.35/ 7.86)	PPEtpsDSDHKKKKKKKEE
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP26119 with Med19 domain of Kingdom Metazoa
Unable to open file!