<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26115
Description |
Mediator complex subunit 28 |
Sequence | MTSSSNVNSNLMDEFEEAFQNCLLSLTKLEANTGSTKEEIEFEAQKTIDRFIDVARQMEAFFLQKRFLVSTLKPDQLIKDENHDLRIEIQRKEALLNKHYSRLEEWKACLAFEQQNPSNLNRPVVGPVIPGVMGEGMAGTSVPGAPMGVGAAAGLGVIPQRSGMLPSMVGQMAQMAGQSSQQHLQNHKILQAQQMQQQLRMMGKLPK |
Length | 207 |
Position | Head |
Organism | Glossina morsitans morsitans (Savannah tsetse fly) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Brachycera> Muscomorpha> Hippoboscoidea>
Glossinidae> Glossina.
|
Aromaticity | 0.05 |
Grand average of hydropathy | -0.396 |
Instability index | 55.28 |
Isoelectric point | 6.44 |
Molecular weight | 23027.26 |
Publications | PubMed=20353571
|
Function
Annotated function |
|
GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP26115
No repeats found
No repeats found
|