Description | Mediator of RNA polymerase II transcription subunit 18 |
Sequence | MMSQVTSSKESLHQALQNRIIPNQEYLLQGSIIESAVDHLLHRLRGLCDNVETSPETFHDLEVCMSMRQQNAQVPINLRVRRALDRDMPFQLRYIGHPEIDRSRPTLVRSSLDVGCTSTVLEFLTELGCRLEYEYISQGYMFRKGRMKITVAKIFKIIPGKPHDSEPVCQSYLVELSVVAPNGQDSIGDEMRAFAEQLKPLVQLEKIDYKRLG |
Length | 213 |
Position | Head |
Organism | Glossina morsitans morsitans (Savannah tsetse fly) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota> Neoptera> Endopterygota> Diptera> Brachycera> Muscomorpha> Hippoboscoidea> Glossinidae> Glossina. |
Aromaticity | 0.06 |
Grand average of hydropathy | -0.326 |
Instability index | 54.20 |
Isoelectric point | 6.60 |
Molecular weight | 24390.86 |
Publications | PubMed=20353571 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364150 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP26114 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 54.61| 14| 30| 128| 141| 4 --------------------------------------------------------------------------- 128- 141 (27.30/17.49) GCRLEYEYISQGYM 160- 173 (27.31/17.49) GKPHDSEPVCQSYL --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) FQLRYI 2) IDYKRL | 90 207 | 95 212 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab