<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26112
Description |
CDK8 kinase-activating protein cyclin C |
Sequence | MAGNFWQSSHSQQWILDRQDLIRERQYDLQILSEDEYQKVFIFFANVIQVLGEQLKLRQQVIATATVYFKRFYARNSLKNIDPLLLAPTCILLASKVEEFGVISNSRLISICQSVIKSKFSYAYTQDFPYRTNHILECEFYLLENLDCCLIVYQPYRPLLQLVQDMGQEDQLLTFSWRIVNDSLRTDVCLLYPPYQIAIACLQIACVILQKDSMKQWFAELNVDLDKVQEIVRAIVNLFELWKDWKEKDEIQMLLAKIPKPKPAPQR |
Length | 267 |
Position | Kinase |
Organism | Glossina morsitans morsitans (Savannah tsetse fly) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Brachycera> Muscomorpha> Hippoboscoidea>
Glossinidae> Glossina.
|
Aromaticity | 0.12 |
Grand average of hydropathy | -0.062 |
Instability index | 53.60 |
Isoelectric point | 5.82 |
Molecular weight | 31459.25 |
Publications | PubMed=20353571
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
kinase activity GO:0016301 IEA:UniProtKB-KW
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP26112
No repeats found
|