<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26101
| Description |
Predicted protein |
| Sequence | MVDSLGVLQRDAPPSITDYQLRNGLPMVSDTTKAVWTPEQLREQSEEAGKNLVAACLEFEKMLDELPTLIRSEEDQTNRLKDFQSQNENQTHLLKQKIDLAEDYLQIVSNSIEDITNNRLQVRHQSKKK |
| Length | 129 |
| Position | Middle |
| Organism | Naegleria gruberi (Amoeba) |
| Kingdom | Heterolobosea |
| Lineage | Eukaryota> Discoba> Heterolobosea> Tetramitia> Eutetramitia>
Vahlkampfiidae> Naegleria.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.804 |
| Instability index | 63.91 |
| Isoelectric point | 4.93 |
| Molecular weight | 14852.50 |
| Publications | PubMed=20211133
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP26101
No repeats found
No repeats found
|