<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26101
Description |
Predicted protein |
Sequence | MVDSLGVLQRDAPPSITDYQLRNGLPMVSDTTKAVWTPEQLREQSEEAGKNLVAACLEFEKMLDELPTLIRSEEDQTNRLKDFQSQNENQTHLLKQKIDLAEDYLQIVSNSIEDITNNRLQVRHQSKKK |
Length | 129 |
Position | Middle |
Organism | Naegleria gruberi (Amoeba) |
Kingdom | Heterolobosea |
Lineage | Eukaryota> Discoba> Heterolobosea> Tetramitia> Eutetramitia>
Vahlkampfiidae> Naegleria.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.804 |
Instability index | 63.91 |
Isoelectric point | 4.93 |
Molecular weight | 14852.50 |
Publications | PubMed=20211133
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP26101
No repeats found
No repeats found
|