<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26094
Description |
Mediator complex subunit 29 (Fragment) |
Sequence | RKMAASQQQAAAASSAAGVSGPGSSGGPGPQQQPQPPAQLVGPAQSGLLQQQQQDFDPVQRYKMLIPQLKESLQTLMKVAAQNLIQNTNIDNGQKSSDGPIQRFDKCLEEFYALCDQLELCLRLAHECLSQSCDSAKHSPTLVPTATKPDAVQPDSLPYPQYLAVIKAQIACAKDIHTALLDCANKVTGKTPAPPTGPGGTL |
Length | 202 |
Position | Tail |
Organism | Ailuropoda melanoleuca (Giant panda) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Laurasiatheria> Carnivora> Caniformia> Ursidae> Ailuropoda.
|
Aromaticity | 0.03 |
Grand average of hydropathy | -0.401 |
Instability index | 68.40 |
Isoelectric point | 6.97 |
Molecular weight | 21341.00 |
Publications | PubMed=20010809
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
nucleoplasm GO:0005654 IEA:Ensembl
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP26094
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 50.68| 14| 167| 16| 29| 1
---------------------------------------------------------------------------
16- 29 (27.75/14.54) AAGVSG..PGSSGGPG
184- 199 (22.93/10.75) ANKVTGktPAPPTGPG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 68.02| 20| 22| 31| 50| 2
---------------------------------------------------------------------------
31- 50 (36.95/18.02) QQQPQPPAQ...LVGPAQSGLLQ
52- 74 (31.07/14.15) QQQDFDPVQrykMLIPQLKESLQ
---------------------------------------------------------------------------
|