<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26093
| Description |
Uncharacterized protein (Fragment) |
| Sequence | MADVLSVGVNLEAFAQAISAIQALRSSVSRVFDCLKDGMRNKETLEGREKAFIAHFQDNLHSVNRDLNELERLSNLVGKPSENHPLHNSGLLSLDPVQDKTPLYSQLLQAYKWSNKLQYHAGLASGLLNQQSLKRSANQMGVSAKRRPKAQPTTLVLPPQ |
| Length | 160 |
| Position | Tail |
| Organism | Ailuropoda melanoleuca (Giant panda) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Laurasiatheria> Carnivora> Caniformia> Ursidae> Ailuropoda.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.438 |
| Instability index | 48.73 |
| Isoelectric point | 9.52 |
| Molecular weight | 17726.99 |
| Publications | PubMed=20010809
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP26093
No repeats found
|