<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26083
| Description |
Mediator of RNA polymerase II transcription subunit 17 |
| Sequence | MSYSVNISVEAPIENQIQEITYDGTEIYQPPLTLSESLTKYAQKIDFSKTSDIDFKKEPGEAIEDNKSDSDSKDAFQSSLWPWDSARNKLRNAFQEVCVLADVLAIAKDKRYMVLDPVQQEPIETKPMVQIYARKKALAGAASVLLTGAERLKTSQNEAARNRTVPDFHIELLRLRQNWRLKKVSNTIIGDLSYRTAGSKYTQTGTFEVTKAEDDDKTNSPPSSPIPGGATTAKTNSALRVSIPSELQGVAYIEVLCQKDQEDLCSVNVNLLGSGPPASNPDMHWQQKLEAAQNVLFCKELFNQLAKEAVQLQAPIPHMVVGNQIMATVFPGIQLIIGLCHSTVGDKKQQNNNSSKTDHDHVLEHSLHQLLREVHHKNTHHPFPHPATGPLGPSKKRMLAGPMAADRYELLEMTKSETLLEQIIKQAQHFFMRLRTEYVLDTIAKEVKDPLISSHWNTLNSPTQSCVKINISTHGYDALCRTPLVIHVGEKSLKCICRDGKVMHMSYEPQELRDLIFCHINQHQILAVQALAKTMGWQFLANSNHLGTGAVEPLGNASSCLLASPTGDRIIAVRCEPQTGIQVCVAHSPRSDFFPSRLVTERKWEHLGGQFRDVRLEKMEGRNFLHKMELLMASLTSSS |
| Length | 639 |
| Position | Head |
| Organism | Tribolium castaneum (Red flour beetle) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Coleoptera> Polyphaga> Cucujiformia>
Tenebrionidae> Tenebrionidae incertae sedis> Tribolium.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.396 |
| Instability index | 45.39 |
| Isoelectric point | 6.93 |
| Molecular weight | 71365.63 |
| Publications | PubMed=18362917
PubMed=19820115
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IBA:GO_Central
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP26083
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 53.15| 14| 16| 474| 487| 1
---------------------------------------------------------------------------
474- 487 (26.65/17.71) HGYDALCRTPLVIH
491- 504 (26.50/17.58) KSLKCICRDGKVMH
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 37.84| 12| 18| 415| 426| 2
---------------------------------------------------------------------------
415- 426 (18.58/11.61) KSETLLEQIIKQ
435- 446 (19.26/12.27) RTEYVLDTIAKE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 97.28| 28| 161| 378| 407| 3
---------------------------------------------------------------------------
378- 407 (46.16/34.37) NTHHpFPHPATGPLGPSKKRMLAGPmAADR
542- 569 (51.12/28.41) NSNH.LGTGAVEPLGNASSCLLASP.TGDR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 41.81| 11| 16| 217| 227| 7
---------------------------------------------------------------------------
217- 227 (22.37/14.72) KTNSPPSSPIP
234- 244 (19.44/11.82) KTNSALRVSIP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 57.76| 16| 21| 303| 323| 9
---------------------------------------------------------------------------
308- 323 (28.51/25.65) EAVQLQAPIPHMVVGN
331- 346 (29.26/13.57) PGIQLIIGLCHSTVGD
---------------------------------------------------------------------------
|