<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26078
| Description |
Mediator of RNA polymerase II transcription subunit 4 |
| Sequence | MNIVVLDPRDIVAYAHRIAGTTSAPKEWQPGFPMFGFMPPAPQEHMMRAGVLSRGIVAEIVTQGPEKYTSTAARVSKEGDGDAMEKLNIPIGLGASDAQIRKQMPPGWKPGDPVDLPLDALLHYMGRSFFTEHGITLPESWKTGDPLPPDAMEILRKKFKLPEKRAALYDDEVVDDVESLRKKRKLEEGDKADEGTAESDSSSDSSDSDEEAPNTISLSLSSSEDESDDDSD |
| Length | 232 |
| Position | Middle |
| Organism | Phytophthora infestans (strain T30-4) (Potato late blight fungus) |
| Kingdom | Oomycetes |
| Lineage | Eukaryota> Sar> Stramenopiles> Oomycota> Peronosporales> Peronosporaceae>
Phytophthora.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.643 |
| Instability index | 53.02 |
| Isoelectric point | 4.56 |
| Molecular weight | 25373.00 |
| Publications | PubMed=19741609
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP26078
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 65.48| 20| 23| 150| 172| 1
---------------------------------------------------------------------------
150- 172 (30.56/25.86) DAMEILRKKFKLPEKRAAlydDE
175- 194 (34.92/20.74) DDVESLRKKRKLEEGDKA...DE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 42.87| 13| 19| 199| 211| 2
---------------------------------------------------------------------------
199- 211 (23.58/11.89) SDSSS.DSSDSDEE
219- 232 (19.29/ 8.61) SLSSSeDESDDDSD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 51.87| 12| 30| 104| 117| 3
---------------------------------------------------------------------------
104- 117 (24.99/21.47) MPPGWKPGDPvdLP
137- 148 (26.88/15.89) LPESWKTGDP..LP
---------------------------------------------------------------------------
|