<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26072
| Description |
Cyclin-dependent kinase 8 |
| Sequence | MDYDFKVKLTGERERVEDLFEYEGCKVGRGTYGHVYKAKRKDGRDDRDYALKQIEGTGISMSACREIALLRELKHPNVISLQKVFLSHADRKVWLLFDFAEHDLWHIIKFHRASKANKKPVQLPRGMVKSLLYQILDGIHYLHANWVLHRDLKPANILVMGEGPERGRVKIADMGFARLFNSPLKPLADLDPVVVTFWYRAPELLLGARHYTKAIDIWAIGCIFAELLTSEPIFHCRQEDIKTSNPYHHDQLDRIFNVMGFPADKDWEDIKKMPEHSTLIKDFRRNTYTNCSLIKYMEKHKVKPDSKTFHLLQKLLTMDPIKRISSEQAMQDPYFLEDPLPTSDVFAGCQIPYPKREFLTEEEPDDKGDKKNQQQQQGNNHTNGTGHPGNQDNSHAQGPPLKKVRVVPPTTTSGGLIMTSDYQRSNPHAAYQNPGPSTSQPQSSMGYSSTSQQPPQYSHQTHRY |
| Length | 464 |
| Position | Kinase |
| Organism | Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Amphibia>
Batrachia> Anura> Pipoidea> Pipidae> Xenopodinae> Xenopus> Silurana.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.709 |
| Instability index | 38.47 |
| Isoelectric point | 8.74 |
| Molecular weight | 53349.07 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
regulated gene transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional pre-initiation complex with RNA polymerase II
and the general transcription factors. Phosphorylates the CTD (C-
terminal domain) of the large subunit of RNA polymerase II (RNAp II),
which may inhibit the formation of a transcription initiation complex
(By similarity).
|
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
nucleus GO:0005634 IBA:GO_Central
|
| GO - Biological Function | ATP binding GO:0005524 IEA:UniProtKB-KW
cyclin-dependent protein serine/threonine kinase activity GO:0004693 IBA:GO_Central
protein kinase activity GO:0004672 ISS:UniProtKB
protein serine kinase activity GO:0106310 IEA:RHEA
protein threonine kinase activity GO:0106311 IEA:RHEA
RNA polymerase II CTD heptapeptide repeat kinase activity GO:0008353 IBA:GO_Central
|
| GO - Biological Process | protein phosphorylation GO:0006468 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP26072
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 132.03| 39| 92| 226| 265| 1
---------------------------------------------------------------------------
226- 265 (68.85/40.22) ELLTSEPIFHCRQEDiKTSNPYH.HDQL..DRIFNVMGFPADK
314- 355 (63.18/33.00) KLLTMDPIKRISSEQ.AMQDPYFlEDPLptSDVFAGCQIPYPK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 55.44| 15| 36| 151| 165| 2
---------------------------------------------------------------------------
151- 165 (26.77/14.65) DLKPANILVMGEGPE
189- 203 (28.67/16.10) DLDPVVVTFWYRAPE
---------------------------------------------------------------------------
|