<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26071

Description Isoform 3 of Cyclin-dependent kinase 8
SequenceMDYDFKVKLSSERERVEDLFEYEGCKVGRGTYGHVYKAKRKDGKDDKDYALKQIEGTGISMSACREIALLRELKHPNVISLLKVFLSHADRKVWLLFDYAEHDLWHIIKFHRASKANKKPVQLPRGMVKSLLYQILDGIHYLHANWVLHRDLKPANILVMGEGPERGRVKIADMGFARLFNSPLKPLADLDPVVVTFWYRAPELLLGARHYTKAIDIWAIGCIFAELLTSEPIFHCRQEDIKTSNPYHHDQLDRIFNVMGFPADKDWEDIKKMPEHSTLMKDFRRNTYTNCSLIKYMEKHKVKPDSKAFHLLQKLLTMDPIKRITSEQAMQDPYFLEDPLPTSDVFAGCQIPYPKREFLTEEEPDEKGDKKTQQQQQGNNHTNGTGHPGNQDSGHAQGPPLKKVRVVPPTTTSGGLIMTSDYQRSNPHAAYPNPGPSTSQPQSSMGYSATSQQPPQYSHQTHRY
Length459
PositionKinase
OrganismMus musculus (Mouse)
KingdomMetazoa
LineageEukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Euarchontoglires> Glires> Rodentia> Myomorpha> Muroidea> Muridae> Murinae> Mus> Mus.
Aromaticity0.09
Grand average of hydropathy-0.678
Instability index39.18
Isoelectric point8.72
Molecular weight53209.07
Publications
PubMed=19468303
PubMed=15489334
PubMed=16141072

Function

Annotated function Component of the Mediator complex, a coactivator involved in regulated gene transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional pre-initiation complex with RNA polymerase II and the general transcription factors. Phosphorylates the CTD (C- terminal domain) of the large subunit of RNA polymerase II (RNAp II), which may inhibit the formation of a transcription initiation complex. Phosphorylates CCNH leading to down-regulation of the TFIIH complex and transcriptional repression. Recruited through interaction with MAML1 to hyperphosphorylate the intracellular domain of NOTCH, leading to its degradation (By similarity).
ECO:0000250	UniProtKB:P49336
GO - Cellular Component
mediator complex	GO:0016592	IDA:MGI
nucleolus	GO:0005730	ISO:MGI
nucleoplasm	GO:0005654	TAS:Reactome
nucleus	GO:0005634	ISO:MGI
protein-containing complex	GO:0032991	ISO:MGI
ubiquitin ligase complex	GO:0000151	ISO:MGI
GO - Biological Function
ATP binding	GO:0005524	IEA:UniProtKB-KW
cyclin-dependent protein serine/threonine kinase activity	GO:0004693	IBA:GO_Central
protein kinase activity	GO:0004672	ISS:UniProtKB
protein serine kinase activity	GO:0106310	IEA:RHEA
protein threonine kinase activity	GO:0106311	IEA:RHEA
RNA polymerase II CTD heptapeptide repeat kinase activity	GO:0008353	IBA:GO_Central
GO - Biological Process
negative regulation of triglyceride metabolic process	GO:0090209	ISO:MGI
protein phosphorylation	GO:0006468	IBA:GO_Central
protein ubiquitination	GO:0016567	ISO:MGI

Interaction

Binary Interactions
[Q8R3L8<-->A2AGH6: Med12]	NbExp=3	EBI-5745402,EBI-5744969

Repeat regions

Repeats

>MDP26071
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     176.32|      54|      87|     209|     265|       1
---------------------------------------------------------------------------
  209-  265 (87.19/66.04)	RHYTKAiDIWAIGcIFAELLTSEPIFHCRQEDiKTSNPYH.HDQL..DRIFNVMGFPADK
  299-  355 (89.13/53.97)	KHKVKP.DSKAFH.LLQKLLTMDPIKRITSEQ.AMQDPYFlEDPLptSDVFAGCQIPYPK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      55.44|      15|      36|     151|     165|       5
---------------------------------------------------------------------------
  151-  165 (26.77/15.62)	DLKPANILVMGEGPE
  189-  203 (28.67/17.17)	DLDPVVVTFWYRAPE
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP26071 with CDK8 domain of Kingdom Metazoa

Intrinsically Disordered Regions

IDR SequenceStartStop
1) YPKREFLTEEEPDEKGDKKTQQQQQGNNHTNGTGHPGNQDSGHAQGPPLKKVRVVPPTTTSGGLIMTSDYQRSNPHAAYPNPGPSTSQPQSSMGYSATSQQPPQYSHQTHRY
353
464

Molecular Recognition Features

MoRF SequenceStartStop
NANANA