<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26068

Description Cyclin-dependent kinase 8
SequenceMGYDFKVKLTGERERVEDLFEYEGCKVGRGTYGHVYKAKRKDGKDDRDYALKQIEGTGISMSACREIALLRELKHPNVISLQKVFLSHADRKVWLLFDYAEHDLWHIIKFHRASKANKKPLQLPRGMVKSLLYQILDGIHYLHANWVLHRDLKPANILVMGEGPERGRVKIADMGFARLSNSPLKPLADLDPVVVTFWYRAPELLLGARHYTKAIDIWAIGCIFAELLTSEPIFHCRQEDIKTSNPYHHDQLDRIFNVMGFPADKDWEDIKKMPEHSTLMKDFRRNTYTNCSLIKYMEKHKVKPDSKAFHLLQKLLTMDPIRRITSEQAMQDPYFLEEPLPTSDVFAGCQIPYPKREFLTEEEPEDKADKKNQQQQQGNNHTNGAGHTGNPDNSHAQGPPLKKVRVVPPTATSSGLIMTSDYQRSNPHAAYQNPGPSTSLPQSSMGYSSTSQQPPQYSHQTHRY
Length464
PositionKinase
OrganismDanio rerio (Zebrafish) (Brachydanio rerio)
KingdomMetazoa
LineageEukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Actinopterygii> Neopterygii> Teleostei> Ostariophysi> Cypriniformes> Danionidae> Danioninae> Danio.
Aromaticity0.09
Grand average of hydropathy-0.683
Instability index40.09
Isoelectric point8.83
Molecular weight53233.06
Publications
PubMed=12031503

Function

Annotated function Component of the Mediator complex, a coactivator involved in regulated gene transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional pre-initiation complex with RNA polymerase II and the general transcription factors. Phosphorylates the CTD (C- terminal domain) of the large subunit of RNA polymerase II (RNAp II), which may inhibit the formation of a transcription initiation complex (By similarity). 
ECO:0000250	UniProtKB:P49336
GO - Cellular Component
mediator complex	GO:0016592	IBA:GO_Central
nucleus	GO:0005634	IBA:GO_Central
GO - Biological Function
ATP binding	GO:0005524	IEA:UniProtKB-KW
cyclin-dependent protein serine/threonine kinase activity	GO:0004693	IBA:GO_Central
protein kinase activity	GO:0004672	ISS:UniProtKB
protein serine kinase activity	GO:0106310	IEA:RHEA
protein threonine kinase activity	GO:0106311	IEA:RHEA
RNA polymerase II CTD heptapeptide repeat kinase activity	GO:0008353	IBA:GO_Central
GO - Biological Process
protein phosphorylation	GO:0006468	IBA:GO_Central

Interaction

Binary Interactions











Repeat regions





Repeats

>MDP26068
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      96.37|      30|      35|     135|     165|       1
---------------------------------------------------------------------------
  135-  165 (51.16/34.01)	ILD.GIHYLhANWVLH..RDLKPANILVMGEGPE
  171-  203 (45.21/25.17)	IADmGFARL.SNSPLKplADLDPVVVTFWYRAPE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     175.15|      54|      87|     209|     265|       2
---------------------------------------------------------------------------
  209-  265 (86.62/61.03)	RHYTKAiDIWAIGcIFAELLTSEPIFHCRQEDiKTSNPYH.HDQL..DRIFNVMGFPADK
  299-  355 (88.53/49.81)	KHKVKP.DSKAFH.LLQKLLTMDPIRRITSEQ.AMQDPYFlEEPLptSDVFAGCQIPYPK
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP26068 with CDK8 domain of Kingdom Metazoa


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) YPKREFLTEEEPEDKADKKNQQQQQGNNHTNGAGHTGNPDNSHAQGPPLKKVRVVPPTATSSGLIMTSDYQRSNPHAAYQNPGPSTSLPQSSMGYSSTSQQPPQYSHQTHRY
353
464










Molecular Recognition Features






MoRF SequenceStartStop




NANANA