<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26067

Description Cyclin-dependent kinase 8
SequenceMTLMIDENFKKQLAQRRERVEDLFYFENSKEIGRGTYGLVYKAVPKKQNGQFPNKEYALKMIEGQGFSMSACREIALFRELRHPNLICLQRVFLTNEKKVWLLLDYAEHDLWHVIKHHRTAKSKKVPIMVPRNMVKNILFQILSGMHYLHSNWVLHRDLKPANILLMGDGPPDMRGRVKIADLGFSRIYANPLKPMAELDPVVVTFWYRAPELLLGAKHYTKAIDVWAIGCIFAELLTAEPLFFCKEEDIKAQNPYHYDQVKRIFHLLGYPSDADWPDMKKMPDHQRLLSDARNEGTPIQTFPNSLHRYFDKWKINSQSSPYRLLVKLLTVDPTKRVSCEEAMNDIYFRKMERPPRETDDVFNKYPIPYAKKEQQMTVAPDQAQQQHQQQQVQMQQQPQMGQQQMMGQPQMVQPQMGQPPMGGAHPGVVAPDGHPHQMMQQQQHPQQHHMQYQGMHDPMQGGMDEGPQAKMMRMGNVPVGRYAPMPPPYGAPQDYHPQQGPPMVQMMQQPGPSGYYPQRPGQPTGAVPGPGPQGYMNPQMGMQMGMRAPGVPPQGYMPGRGMAPPQMGQQQPGPNQQQQQQWQQQYHR
Length588
PositionKinase
OrganismCaenorhabditis elegans
KingdomMetazoa
LineageEukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida> Rhabditina> Rhabditomorpha> Rhabditoidea> Rhabditidae> Peloderinae> Caenorhabditis.
Aromaticity0.09
Grand average of hydropathy-0.763
Instability index55.89
Isoelectric point9.24
Molecular weight67784.48
Publications
PubMed=9851916

Function

Annotated function Component of the Mediator complex, a coactivator involved in regulated gene transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional pre-initiation complex with RNA polymerase II and the general transcription factors. Phosphorylates the CTD (C- terminal domain) of the large subunit of RNA polymerase II (RNAp II), which may inhibit the formation of a transcription initiation complex (By similarity). 
ECO:0000250	UniProtKB:Q9VT57
GO - Cellular Component
mediator complex	GO:0016592	IBA:GO_Central
nucleus	GO:0005634	ISS:UniProtKB
GO - Biological Function
ATP binding	GO:0005524	IEA:UniProtKB-KW
cyclin-dependent protein serine/threonine kinase activity	GO:0004693	IBA:GO_Central
protein serine kinase activity	GO:0106310	IEA:RHEA
protein threonine kinase activity	GO:0106311	IEA:RHEA
RNA polymerase II CTD heptapeptide repeat kinase activity	GO:0008353	IBA:GO_Central
GO - Biological Process
G1/S transition of mitotic cell cycle	GO:0000082	ISS:UniProtKB
protein phosphorylation	GO:0006468	ISS:UniProtKB

Interaction

Binary Interactions











Repeat regions





Repeats

>MDP26067
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             6|     192.54|      19|      19|     397|     415|       1
---------------------------------------------------------------------------
  397-  411 (28.61/ 6.72)	QP.QMGQQQMMG.QPQM....
  413-  432 (30.15/ 7.48)	QP.QMGQPPMGGaHPGVVAPD
  434-  453 (30.68/ 7.74)	HPhQMMQQQQHP.QQHHMQYQ
  500-  518 (33.15/ 8.97)	GP.PMVQMMQQP.GPSGYYPQ
  537-  554 (34.86/ 9.82)	NP.QMGMQMGMR.APG.VPPQ
  564-  581 (35.09/ 9.93)	PP.QMGQQQ.PG.PNQQQQQQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      57.70|      15|      64|     457|     471|       2
---------------------------------------------------------------------------
  457-  471 (29.04/10.51)	DPMQGGMDEGPQAKM
  522-  536 (28.65/10.26)	QPTGAVPGPGPQGYM
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP26067 with CDK8 domain of Kingdom Metazoa


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) AMNDIYFRKMERPPRETDDVFNKYPIPYAKKEQQMTVAPDQAQQQHQQQQVQMQQQPQMGQQQMMGQPQMVQPQMGQPPMGGAHPGVVAPDGHPHQMMQQQQHPQQHHMQYQGMHDPMQGGMDEGPQAKMMRMGNVPVGRYAPMPPPYGAPQDYHPQQGPPMVQMMQQPGPSGYYPQRPGQPTGAVPGPGPQGYMNPQMGMQMGMRAPGVPPQGYMPGRGMAPPQMGQQQPGPNQQQQQQWQQQYHR
342
588










Molecular Recognition Features






MoRF SequenceStartStop




1) QQQQQQWQQQYHR
576
588