<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26062
Description |
Cyclin-C |
Sequence | MAGNFWQSSHYLQWILDKQDLLKERQKDLKFLSEEEYWKLQIFFTNVIQALGEHLKLRQQVIATATVYFKRFYARYSLKSIDPVLMAPTCVFLASKVEEFGVVSNTRLISAATSVLKTRFSYAFPKEFPYRMNHILECEFYLLELMDCCLIVYHPYRPLLQYVQDMGQEDMLLPLAWRIVNDTYRTDLCLLYPPFMIALACLHVACVVQQKDARQWFAELSVDMEKILEIIRVILKLYEQWKNFDERKEMATILNKMPKPKPPPNSEGEQGTNGSQSSGYSQS |
Length | 283 |
Position | Kinase |
Organism | Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Amphibia>
Batrachia> Anura> Pipoidea> Pipidae> Xenopodinae> Xenopus> Silurana.
|
Aromaticity | 0.13 |
Grand average of hydropathy | -0.162 |
Instability index | 51.23 |
Isoelectric point | 6.95 |
Molecular weight | 33232.31 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
regulated gene transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors. Binds to and activates cyclin-
dependent kinase cdk8 that phosphorylates the CTD (C-terminal domain)
of the large subunit of RNA polymerase II (RNAp II), which may inhibit
the formation of a transcription initiation complex (By similarity).
ECO:0000250
|
GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
nucleus GO:0005634 IBA:GO_Central
|
GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IBA:GO_Central
|
GO - Biological Process | glomerular visceral epithelial cell development GO:0072015 IEA:Ensembl
positive regulation of transcription by RNA polymerase II GO:0045944 IBA:GO_Central
regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
Repeats |
>MDP26062
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 80.46| 24| 30| 4| 27| 1
---------------------------------------------------------------------------
4- 27 (43.23/27.83) NFWQSSHYLQWILDK.QDLLKERQK
36- 60 (37.23/23.09) EYWKLQIFFTNVIQAlGEHLKLRQQ
---------------------------------------------------------------------------
|