<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26061
| Description |
Cyclin-C |
| Sequence | MAGNFWQSSHYLQWILDKERQKDLKFLSEEEYWKLQIFFTNVIQALGEHLKLRQQVIATATVYFKRFYARYSLKSIDPVLMAPTCVFLASKVEEFGVVSNTSLIAATTSVLKTRFSYASPKEFPYRMNHILECEFYLLELMDCCLIVYHPYRPLLQYVQDMGQEDVLLPLAWRIVNDTYRTDLCLLYPPFMIALACLHVACVVQQKDARQWFAELSVDMEKILEIIRVILKLYEQWKNFDERKEMATILSKMPKPKPPPNSEGEQGPNGSQNSSYSQS |
| Length | 278 |
| Position | Kinase |
| Organism | Rattus norvegicus (Rat) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Glires> Rodentia> Myomorpha> Muroidea> Muridae>
Murinae> Rattus.
|
| Aromaticity | 0.13 |
| Grand average of hydropathy | -0.149 |
| Instability index | 50.34 |
| Isoelectric point | 6.53 |
| Molecular weight | 32513.40 |
| Publications | PubMed=8336937
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
regulated gene transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors. Binds to and activates cyclin-
dependent kinase CDK8 that phosphorylates the CTD (C-terminal domain)
of the large subunit of RNA polymerase II (RNAp II), which may inhibit
the formation of a transcription initiation complex (By similarity).
|
| GO - Cellular Component | mediator complex GO:0016592 ISO:RGD
nucleus GO:0005634 IDA:RGD
ubiquitin ligase complex GO:0000151 IDA:RGD
|
| GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IBA:GO_Central
identical protein binding GO:0042802 ISO:RGD
|
| GO - Biological Process | negative regulation of triglyceride metabolic process GO:0090209 IMRGD
positive regulation of transcription by RNA polymerase II GO:0045944 IBA:GO_Central
protein ubiquitination GO:0016567 IDA:RGD
regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP26061
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 52.14| 17| 22| 80| 99| 1
---------------------------------------------------------------------------
80- 99 (24.83/26.90) LMAPTCVFLASKveeFGVVS
103- 119 (27.30/19.70) LIAATTSVLKTR...FSYAS
---------------------------------------------------------------------------
|