<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26060

Description Cyclin-C
SequenceMAGNFWQSSHYLQWILDKQDLLKERQKDLKFLSEEEYWKLQIFFTNVIQALGEHLKLRQQVIATATVYFKRFYARYSLKSIDPVLMAPTCVFLASKVEEFGVVSNTRLIAATTSVLKTRFSYAFPKEFPYRMNHILECEFYLLELMDCCLIVYHPYRPLLQYVQDMGQEDVLLPLAWRIVNDTYRTDLCLLYPPFMIALACLHVACVVQQKDARQWFAELSVDMEKILEIIRVILKLYEQWKNFDERKEMATILSKMPKPKPPPNSEGEQGPNGSQNSSYSQS
Length283
PositionKinase
OrganismMus musculus (Mouse)
KingdomMetazoa
LineageEukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Euarchontoglires> Glires> Rodentia> Myomorpha> Muroidea> Muridae> Murinae> Mus> Mus.
Aromaticity0.13
Grand average of hydropathy-0.158
Instability index49.97
Isoelectric point6.95
Molecular weight33240.31
Publications
PubMed=19468303
PubMed=15489334

Function

Annotated function Component of the Mediator complex, a coactivator involved in regulated gene transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. Binds to and activates cyclin- dependent kinase CDK8 that phosphorylates the CTD (C-terminal domain) of the large subunit of RNA polymerase II (RNAp II), which may inhibit the formation of a transcription initiation complex (By similarity).
ECO:0000250	
GO - Cellular Component
mediator complex	GO:0016592	IDA:MGI
nucleoplasm	GO:0005654	TAS:Reactome
nucleus	GO:0005634	ISO:MGI
ubiquitin ligase complex	GO:0000151	ISO:MGI
GO - Biological Function
cyclin-dependent protein serine/threonine kinase regulator activity	GO:0016538	IBA:GO_Central
identical protein binding	GO:0042802	ISO:MGI
GO - Biological Process
negative regulation of triglyceride metabolic process	GO:0090209	ISO:MGI
positive regulation of transcription by RNA polymerase II	GO:0045944	IBA:GO_Central
protein ubiquitination	GO:0016567	ISO:MGI
regulation of transcription by RNA polymerase II	GO:0006357	IBA:GO_Central

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP26060
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      80.46|      24|      30|       4|      27|       1
---------------------------------------------------------------------------
    4-   27 (43.23/27.73)	NFWQSSHYLQWILDK.QDLLKERQK
   36-   60 (37.23/23.00)	EYWKLQIFFTNVIQAlGEHLKLRQQ
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP26060 with CycC domain of Kingdom Metazoa

Intrinsically Disordered Regions

IDR SequenceStartStop
1) TILSKMPKPKPPPNSEGEQGPNGSQNSSYSQS
252
283

Molecular Recognition Features

MoRF SequenceStartStop
NANANA