<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26059

Description Isoform 2 of Cyclin-C
SequenceMAGNFWQSSHYLQWILDKQDLLKERQKDLKFLSEEEYWKLQIFFTNVIQALGEHLKLRQQVIATATVYFKRFYARYSLKSIDPVLMAPTCVFLASKVEEFGVVSNTRLIAAATSVLKTRFSYAFPKEFPYRMNHILECEFYLLELMDCCLIVYHPYRPLLQYVQDMGQEDMLLPLAWRIVNDTYRTDLCLLYPPFMIALACLHVACVVQQKDARQWFAELSVDMEKILEIIRVILKLYEQWKNFDERKEMATILSKMPKPKPPPNSEGEQGPNGSQNSSYSQS
Length198
PositionKinase
OrganismHomo sapiens (Human)
KingdomMetazoa
LineageEukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Euarchontoglires> Primates> Haplorrhini> Catarrhini> Hominidae> Homo.
Aromaticity0.13
Grand average of hydropathy-0.158
Instability index49.97
Isoelectric point6.95
Molecular weight33242.35
Publications
PubMed=1833066
PubMed=8833152
PubMed=14702039
PubMed=14574404
PubMed=8700522
PubMed=9734358
PubMed=10024883
PubMed=10993082
PubMed=15175163
PubMed=16595664
PubMed=17525332
PubMed=19369195
PubMed=21806996

Function

Annotated function Component of the Mediator complex, a coactivator involved in regulated gene transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. Binds to and activates cyclin- dependent kinase CDK8 that phosphorylates the CTD (C-terminal domain) of the large subunit of RNA polymerase II (RNAp II), which may inhibit the formation of a transcription initiation complex. 
ECO:0000269	PubMed:16595664
ECO:0000269	PubMed:8700522
GO - Cellular Component
mediator complex	GO:0016592	IBA:GO_Central
nucleoplasm	GO:0005654	TAS:Reactome
nucleus	GO:0005634	IBA:GO_Central
GO - Biological Function
cyclin-dependent protein serine/threonine kinase regulator activity	GO:0016538	IBA:GO_Central
identical protein binding	GO:0042802	IPI:IntAct
GO - Biological Process
positive regulation of transcription by RNA polymerase II	GO:0045944	IBA:GO_Central
regulation of transcription by RNA polymerase II	GO:0006357	IBA:GO_Central
regulation of transcription initiation from RNA polymerase II promoter	GO:0060260	TAS:Reactome

Interaction

Binary Interactions
[P24863<-->Q92870-2: APBB2]	NbExp=3	EBI-395261,EBI-21535880
[P24863<-->Q9UBL3: ASH2L]	NbExp=3	EBI-395261,EBI-540797
[P24863<-->Q6QNY1: BLOC1S2]	NbExp=3	EBI-395261,EBI-465872
[P24863<-->Q9BX70: BTBD2]	NbExp=3	EBI-395261,EBI-710091
[P24863<-->P55212: CASP6]	NbExp=3	EBI-395261,EBI-718729
[P24863<-->Q8TD31-3: CCHCR1]	NbExp=3	EBI-395261,EBI-10175300
[P24863<-->P24863: CCNC]	NbExp=3	EBI-395261,EBI-395261
[P24863<-->Q00526: CDK3]	NbExp=7	EBI-395261,EBI-1245761
[P24863<-->Q00535: CDK5]	NbExp=2	EBI-395261,EBI-1041567
[P24863<-->P49336: CDK8]	NbExp=36	EBI-395261,EBI-394377
[P24863<-->P42772: CDKN2B]	NbExp=3	EBI-395261,EBI-711280
[P24863<-->Q96M91: CFAP53]	NbExp=3	EBI-395261,EBI-742422
[P24863<-->P61024: CKS1B]	NbExp=3	EBI-395261,EBI-456371
[P24863<-->O43186: CRX]	NbExp=4	EBI-395261,EBI-748171
[P24863<-->Q8WWB3: DYDC1]	NbExp=3	EBI-395261,EBI-740680
[P24863<-->Q3B820: FAM161A]	NbExp=3	EBI-395261,EBI-719941
[P24863<-->Q9Y247: FAM50B]	NbExp=3	EBI-395261,EBI-742802
[P24863<-->Q86YD7: FAM90A1]	NbExp=3	EBI-395261,EBI-6658203
[P24863<-->O15409: FOXP2]	NbExp=3	EBI-395261,EBI-983612
[P24863<-->Q6PJQ5: FOXR2]	NbExp=3	EBI-395261,EBI-8468543
[P24863<-->Q8TAE8: GADD45GIP1]	NbExp=3	EBI-395261,EBI-372506
[P24863<-->P14136: GFAP]	NbExp=3	EBI-395261,EBI-744302
[P24863<-->Q53GS7: GLE1]	NbExp=3	EBI-395261,EBI-1955541
[P24863<-->Q49A26: GLYR1]	NbExp=3	EBI-395261,EBI-2804292
[P24863<-->Q08379: GOLGA2]	NbExp=3	EBI-395261,EBI-618309
[P24863<-->A0A024R8L2: hCG_1987119]	NbExp=3	EBI-395261,EBI-14103818
[P24863<-->P42858: HTT]	NbExp=9	EBI-395261,EBI-466029
[P24863<-->Q9ULR0: ISY1]	NbExp=3	EBI-395261,EBI-2557660
[P24863<-->A1A4E9: KRT13]	NbExp=3	EBI-395261,EBI-10171552
[P24863<-->P19012: KRT15]	NbExp=3	EBI-395261,EBI-739566
[P24863<-->P08779: KRT16]	NbExp=3	EBI-395261,EBI-356410
[P24863<-->Q7Z3Y8: KRT27]	NbExp=3	EBI-395261,EBI-3044087
[P24863<-->Q15323: KRT31]	NbExp=6	EBI-395261,EBI-948001
[P24863<-->O76011: KRT34]	NbExp=3	EBI-395261,EBI-1047093
[P24863<-->P13473-2: LAMP2]	NbExp=3	EBI-395261,EBI-21591415
[P24863<-->P80188: LCN2]	NbExp=3	EBI-395261,EBI-11911016
[P24863<-->Q9BRK4: LZTS2]	NbExp=3	EBI-395261,EBI-741037
[P24863<-->O95983-2: MBD3]	NbExp=3	EBI-395261,EBI-11978579
[P24863<-->Q9NS73-5: MBIP]	NbExp=3	EBI-395261,EBI-10182361
[P24863<-->P50222: MEOX2]	NbExp=3	EBI-395261,EBI-748397
[P24863<-->Q6FHY5: MEOX2]	NbExp=3	EBI-395261,EBI-16439278
[P24863<-->O14880: MGST3]	NbExp=3	EBI-395261,EBI-724754
[P24863<-->P17568: NDUFB7]	NbExp=3	EBI-395261,EBI-1246238
[P24863<-->P19404: NDUFV2]	NbExp=6	EBI-395261,EBI-713665
[P24863<-->I6L9F6: NEFL]	NbExp=3	EBI-395261,EBI-10178578
[P24863<-->Q9HAN9: NMNAT1]	NbExp=4	EBI-395261,EBI-3917542
[P24863<-->Q96F24: NRBF2]	NbExp=3	EBI-395261,EBI-2362014
[P24863<-->Q02548: PAX5]	NbExp=3	EBI-395261,EBI-296331
[P24863<-->Q96AQ6: PBXIP1]	NbExp=3	EBI-395261,EBI-740845
[P24863<-->Q8TD55-2: PLEKHO2]	NbExp=3	EBI-395261,EBI-12905986
[P24863<-->O60664: PLIN3]	NbExp=3	EBI-395261,EBI-725795
[P24863<-->D3DTS7: PMP22]	NbExp=3	EBI-395261,EBI-25882629
[P24863<-->Q96PV4: PNMA5]	NbExp=4	EBI-395261,EBI-10171633
[P24863<-->P78424: POU6F2]	NbExp=3	EBI-395261,EBI-12029004
[P24863<-->Q99633: PRPF18]	NbExp=3	EBI-395261,EBI-2798416
[P24863<-->O75400-2: PRPF40A]	NbExp=3	EBI-395261,EBI-5280197
[P24863<-->Q9UHX1: PUF60]	NbExp=3	EBI-395261,EBI-1053259
[P24863<-->P06400: RB1]	NbExp=4	EBI-395261,EBI-491274
[P24863<-->Q96IZ5: RBM41]	NbExp=3	EBI-395261,EBI-740773
[P24863<-->Q04864-2: REL]	NbExp=3	EBI-395261,EBI-10829018
[P24863<-->P40937: RFC5]	NbExp=5	EBI-395261,EBI-712376
[P24863<-->Q8N443: RIBC1]	NbExp=5	EBI-395261,EBI-10265323
[P24863<-->P15927: RPA2]	NbExp=3	EBI-395261,EBI-621404
[P24863<-->Q9BVN2: RUSC1]	NbExp=3	EBI-395261,EBI-6257312
[P24863<-->Q9UJW9: SERTAD3]	NbExp=3	EBI-395261,EBI-748621
[P24863<-->Q9Y371: SH3GLB1]	NbExp=3	EBI-395261,EBI-2623095
[P24863<-->Q92529: SHC3]	NbExp=3	EBI-395261,EBI-79084
[P24863<-->Q99932-2: SPAG8]	NbExp=3	EBI-395261,EBI-11959123
[P24863<-->Q7Z699: SPRED1]	NbExp=3	EBI-395261,EBI-5235340
[P24863<-->Q6ZRS2-3: SRCAP]	NbExp=3	EBI-395261,EBI-12029182
[P24863<-->O75528: TADA3]	NbExp=3	EBI-395261,EBI-473249
[P24863<-->Q8N8B7-2: TCEANC]	NbExp=3	EBI-395261,EBI-11955057
[P24863<-->Q96N21: TEPSIN]	NbExp=3	EBI-395261,EBI-11139477
[P24863<-->Q9BXU0: TEX12]	NbExp=3	EBI-395261,EBI-12090309
[P24863<-->Q9Y228: TRAF3IP3]	NbExp=3	EBI-395261,EBI-765817
[P24863<-->Q9HCM9: TRIM39]	NbExp=4	EBI-395261,EBI-739510
[P24863<-->P61086: UBE2K]	NbExp=3	EBI-395261,EBI-473850
[P24863<-->P40337-2: VHL]	NbExp=3	EBI-395261,EBI-12157263
[P24863<-->Q9NP79: VTA1]	NbExp=3	EBI-395261,EBI-740160
[P24863<-->Q8TF47: ZFP90]	NbExp=3	EBI-395261,EBI-11419867
[P24863<-->P17022: ZNF18]	NbExp=4	EBI-395261,EBI-8648067
[P24863<-->Q9BUY5: ZNF426]	NbExp=3	EBI-395261,EBI-743265
[P24863<-->Q6ZNG0: ZNF620]	NbExp=3	EBI-395261,EBI-4395669
[P24863<-->P0C7X2: ZNF688]	NbExp=3	EBI-395261,EBI-4395732
[P24863<-->Q3KQV3: ZNF792]	NbExp=3	EBI-395261,EBI-10240849

Repeat regions

Repeats

>MDP26059
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      80.46|      24|      30|       4|      27|       1
---------------------------------------------------------------------------
    4-   27 (43.23/27.73)	NFWQSSHYLQWILDK.QDLLKERQK
   36-   60 (37.23/23.00)	EYWKLQIFFTNVIQAlGEHLKLRQQ
---------------------------------------------------------------------------

Associated diseases

Disease
colon cancer	PMID:21806996
cancer	PMID:32463833
colorectal cancers	PMID:32206448
Gastric cancer	PMID:32206448
obesity and metabolic diseases	PMID:28351837 PMID:30352217


Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP26059 with CycC domain of Kingdom Metazoa



     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) TILSKMPKPKPPPNSEGEQGPNGSQNSSYSQS
252
283










Molecular Recognition Features






MoRF SequenceStartStop




NANANA