<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26058
Description |
Cyclin-C |
Sequence | MAGNFWQSSHSQQWILDKQDLLRERQHDLLSLNEDEYQKVFIFFANVIQVLGEQLKLRQQVIATATVYFKRFYARNSLKNIDPLLLAPTCILLASKVEEFGVISNSRLISICQSAIKTKFSYAYTQEFPYRTNHILECEFYLLENLDCCLIVYQPYRPLLQLVQDMGQEDQLLTLSWRIVNDSLRTDVCLLYPPYQIAIACLQIACVILQKDSTKQWFAELNVDLDKVQEIVRAIVNLYEMWKDWKEKDEIQMLLSKIPKPKPPPQR |
Length | 267 |
Position | Kinase |
Organism | Drosophila pseudoobscura pseudoobscura (Fruit fly) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Brachycera> Muscomorpha> Ephydroidea>
Drosophilidae> Drosophila> Sophophora.
|
Aromaticity | 0.11 |
Grand average of hydropathy | -0.131 |
Instability index | 49.83 |
Isoelectric point | 5.99 |
Molecular weight | 31403.14 |
Publications | PubMed=15632085
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
regulated gene transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors. Binds to and activates cyclin-
dependent kinase Cdk8 that phosphorylates the CTD (C-terminal domain)
of the large subunit of RNA polymerase II (RNAp II), which may inhibit
the formation of a transcription initiation complex (By similarity).
ECO:0000250
|
GO - Cellular Component | mediator complex GO:0016592 ISS:UniProtKB
|
GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:EnsemblMetazoa
transcription coregulator activity GO:0003712 ISS:UniProtKB
|
GO - Biological Process | chaeta development GO:0022416 IEA:EnsemblMetazoa
imaginal disc-derived leg segmentation GO:0036011 IEA:EnsemblMetazoa
positive regulation of autophagy GO:0010508 IEA:EnsemblMetazoa
regulation of transcription by RNA polymerase II GO:0006357 ISS:UniProtKB
sex comb development GO:0045498 IEA:EnsemblMetazoa
snRNA 3'-end processing GO:0034472 IEA:EnsemblMetazoa
|
Interaction
Repeat regions
Repeats |
>MDP26058
No repeats found
|