<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26053
Description |
Cyclin-C |
Sequence | MAGNFWQSSHHQQWILDKQDLIRERQHDLKTLSEEEYQKLFMFFANIIQVLGEQLKLRQQVIATATVYFKRFYARNSLKCIDPLLLAPTCILLSSKVEEFGVISNSRLITTCQTVIKNKFSYAYQQEFPYRTNHILECEFYLLENLDCCLIVYQPYRPLLQLMQDIGQEEQLLTLTWRLINDSLRTDVSLLYPPYQIAIGCLQIACVILQKELKSWFAELNVDMDKVQEIARAIVNLFELWKGYDEKKEIQALLEKMPKPKPHPQR |
Length | 266 |
Position | Kinase |
Organism | Anopheles gambiae (African malaria mosquito) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Nematocera> Culicoidea> Culicidae>
Anophelinae> Anopheles.
|
Aromaticity | 0.11 |
Grand average of hydropathy | -0.185 |
Instability index | 51.83 |
Isoelectric point | 6.53 |
Molecular weight | 31443.28 |
Publications | PubMed=12364791
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
regulated gene transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors. Binds to and activates cyclin-
dependent kinase Cdk8 that phosphorylates the CTD (C-terminal domain)
of the large subunit of RNA polymerase II (RNAp II), which may inhibit
the formation of a transcription initiation complex (By similarity).
ECO:0000250
|
GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
nucleus GO:0005634 IBA:GO_Central
|
GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IBA:GO_Central
|
GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IBA:GO_Central
regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
Repeats |
>MDP26053
No repeats found
|