<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26052
| Description |
Cyclin-C |
| Sequence | MAGNFWQSSHHQQWILDKQDLIRERQHDLKNLTEEEYQKIFMFFANVIQVLGEQLKLRQQVIATATVYFKRFYARNSLKCIDPLLLAPTCILLASKVEEFGVISNSRLITTCQTVIKNKFSYAYQQEFPYRTNHILECEFYLLENLDCCLIVYQPYRPLLQLIQDIGQEDQLLTLTWRLINDSLRTDVSLLYPPYQIAIGCLQIACVILQKELKAWFAELNVDMEKVQEIARAILNVFELWKSYDEKEIQGLLEKMPKPKPAPQR |
| Length | 265 |
| Position | Kinase |
| Organism | Aedes aegypti (Yellowfever mosquito) (Culex aegypti) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Nematocera> Culicoidea> Culicidae>
Culicinae> Aedini> Aedes> Stegomyia.
|
| Aromaticity | 0.11 |
| Grand average of hydropathy | -0.142 |
| Instability index | 52.23 |
| Isoelectric point | 6.14 |
| Molecular weight | 31228.00 |
| Publications | PubMed=17510324
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
regulated gene transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors. Binds to and activates cyclin-
dependent kinase Cdk8 that phosphorylates the CTD (C-terminal domain)
of the large subunit of RNA polymerase II (RNAp II), which may inhibit
the formation of a transcription initiation complex (By similarity).
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP26052
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 66.55| 21| 26| 105| 130| 1
---------------------------------------------------------------------------
105- 130 (29.24/29.28) NSrlITTCQTVIKNKFSYA...YQqefPY
133- 156 (37.30/21.12) NH..ILECEFYLLENLDCClivYQ...PY
---------------------------------------------------------------------------
|