<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26044
| Description |
Mediator of RNA polymerase II transcription subunit 13 |
| Sequence | MDQSEIDFWVGLAQTEQQASVSLTLITVDTSPSLQLVPPAVKVPPTASTSFYTTPVSTPQPSTVSPDQIGTPSTPMKDGSQANASTPTGTPGGADVTEPAEGDAILVDVTDQTWGAVLSHRLGNSTAPGELSTSLISGYLVKRGGTKVEDPPVVMEVNIVHTDGNPRALEALLREMLNYFRGLGTLARARGIVDRETDVRPWHIAAAEKGVRALYLLM |
| Length | 218 |
| Position | Kinase |
| Organism | Verticillium alfalfae (strain VaMs.102 / ATCC MYA-4576 / FGSC 10136) (Verticillium wilt of alfalfa) (Verticillium albo-atrum) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Hypocreomycetidae> Glomerellales> Plectosphaerellaceae> Verticillium.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.144 |
| Instability index | 33.98 |
| Isoelectric point | 4.72 |
| Molecular weight | 23047.68 |
| Publications | PubMed=21829347
|
Function
| Annotated function |
Component of the SRB8-11 complex. The SRB8-11 complex is a
regulatory module of the Mediator complex which is itself involved in
regulation of basal and activated RNA polymerase II-dependent
transcription. The SRB8-11 complex may be involved in the
transcriptional repression of a subset of genes regulated by Mediator.
It may inhibit the association of the Mediator complex with RNA
polymerase II to form the holoenzyme complex.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP26044
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 144.48| 40| 50| 56| 99| 1
---------------------------------------------------------------------------
28- 55 (31.07/ 8.12) VDT.SPSlQLVPPAVKVPPT....ASTSFYTTP..............
57- 98 (58.78/30.56) .STPQPS.TVSPDQIGTPSTPmkdGSQANASTPTG...TPGGADVTE
109- 150 (54.63/20.36) VTDQTWG.AVLSHRLGNSTAP....GELSTSLISGylvKRGGTKVED
---------------------------------------------------------------------------
|