<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26040

Description Mediator of RNA polymerase II transcription subunit 14
SequenceMENGVQNGAHSNHDRDVKVNGGAVAVDSPAALDKGKGAAAGTSDAAAQNGHGDKTVPPPNVQDAQRGTSTVSLPNRSRMNDLPDEIQYITQGFIPLSTIILRLAQATHDDLEKAIMDAARIKYSPPAINGSATGGGDPPDDSSEANKARKLTLLKFAQDAHTKWVKALVITDWSRKASTVSKLIDLKAHLDKKRSLFDFTLTELIELKRSLGQARLPRPDLKTALQILTTGEAPWIPEPGYIPPPSLTPEEQLKWIEELNTLLSLRLNLDDYDKIPQQFKNYTIKSGRVTFTVEGEFEVDLTIADEDFEKQFWFIDFRFDFTPSSERLSDALVAYLEGQVNDVLSREGLEGCYRFLHEFVLTHKINELKRQAIDLVRNSWTGNLKVEPLNRALAIQYWTSRYGSQAPKSWVMVAVQSGKQKNGLPDPKHPSHLVARWYRDNKEIKDVKLHLNIQEISAEALLKSAIAKHVEHILSSIHDKLAAAPRFANRQAYMRLDISRSEPLDSSLEMQLGGKKVVKLLIEPITGFAAIQPHTRYGLQGETRINHGGKDPAEDGVACLENIRWGYVVDEFNRRGRSCGWAMTKMPVGNEEVKRLIKTREPFQPVFFQRQGLGQDWFVLMSLSLAGDEWWLIEVTRNGASRAVTTSIQLPFSKGQPELNDKFWNNLTSLAAGMISQAIELGELKRNRIDHTAKDMHSRWLTQQIRIPVIFIRLAHILGSPDSLAQTRAQDRRVQSSAPSIDRLVGFLDAMRCAKGAVQCTEVGLGKVKFSYSDIVLPGETGEPRQWTAVLDMSRSGTRLILEPDNPHLRILDLLTKVVNTEKGLRVMMAYMTDVLPILRVFDTIEKKWEEVEAAGQGHIELLTPAADWFAIRYSLPGTAGPARQLTIDVRSKERQAQPYWFASRKQRGPPSPADDEFKAVLQGVWESRGENWRGLTTGAVAQMGMGVFEMIQAIDDAVRAYATGNGQADDNASTAGLPTQVSQVFSSQGSGNGTPQTSQAQSQKQASQASQGQQPQRPRPSQTPNQNQMRKPSFGKQGGGAKGPVGGKNAPVVVLD
Length1057
PositionTail
OrganismVerticillium alfalfae (strain VaMs.102 / ATCC MYA-4576 / FGSC 10136) (Verticillium wilt of alfalfa) (Verticillium albo-atrum)
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Hypocreomycetidae> Glomerellales> Plectosphaerellaceae> Verticillium.
Aromaticity0.07
Grand average of hydropathy-0.451
Instability index44.36
Isoelectric point8.66
Molecular weight117164.55
Publications
PubMed=21829347

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. 
ECO:0000256	RuleBase:RU365082
GO - Cellular Component
mediator complex	GO:0016592	IEA:UniProtKB-UniRule
GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:UniProtKB-UniRule
GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro

Interaction

Binary Interactions











Repeat regions





Repeats

>MDP26040
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     106.26|      24|      25|     988|    1011|       1
---------------------------------------------------------------------------
  965-  986 (29.83/14.27)	..GNGQADDNASTAGLPTQVSQVF
  988- 1009 (33.27/16.79)	SQGSGNGTPQTSQAQSQKQASQ..
 1011- 1034 (43.15/24.03)	SQGQQPQRPRPSQTPNQNQMRKPS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      97.35|      25|      27|      58|      82|       2
---------------------------------------------------------------------------
   29-   56 (25.24/12.02)	.PAALDkgkgAAAG...TSDAAAQ.NGHGDKTV
   58-   82 (43.33/25.99)	PPNVQD....AQRG...TSTVSLP.NRSRMNDL
   83-  111 (28.78/14.75)	PDEIQY....ITQGfipLSTIILRlAQATHDDL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      56.95|      17|      25|     904|     927|       3
---------------------------------------------------------------------------
  908-  927 (27.69/24.84)	RGPPSPAddeFKAVLQGVWE
  934-  950 (29.26/ 9.58)	RGLTTGA...VAQMGMGVFE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      56.96|      18|      30|     140|     161|       9
---------------------------------------------------------------------------
  140-  161 (24.86/26.86)	DDSSEANKARKLTLLKfaqdAH
  172-  189 (32.11/21.44)	DWSRKASTVSKLIDLK....AH
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      66.75|      21|      33|     270|     296|      10
---------------------------------------------------------------------------
  270-  296 (24.76/32.69)	DDYDKipqQFknYTIkSGRVTFTVEGE
  306-  326 (41.99/26.09)	EDFEK...QF..WFI.DFRFDFTPSSE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      43.03|      10|      33|     572|     581|      11
---------------------------------------------------------------------------
  572-  581 (22.06/13.89)	FNRRGRSCGW
  608-  617 (20.96/12.78)	FQRQGLGQDW
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      29.52|      10|      22|     336|     346|      12
---------------------------------------------------------------------------
  336-  346 (12.49/14.43)	LEGQVNDvLSR
  361-  370 (17.03/12.73)	LTHKINE.LKR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      83.93|      26|     476|     397|     425|      16
---------------------------------------------------------------------------
  397-  425 (38.29/32.24)	YwtSRYGSQAPKSWVMVAVQSgKQKNGLP
  874-  899 (45.64/25.24)	Y..SLPGTAGPARQLTIDVRS.KERQAQP
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP26040 with Med14 domain of Kingdom Fungi


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) MENGVQNGAHSNHDRDVKVNGGAVAVDSPAALDKGKGAAAGTSDAAAQNGHGDKTVPPPNVQDAQRGTSTVSLPNRSRMNDL
2) VRAYATGNGQADDNASTAGLPTQVSQVFSSQGSGNGTPQTSQAQSQKQASQASQGQQPQRPRPSQTPNQNQMRKPSFGKQGGGAKGPVGGKNAPVVVLD
1
959
82
1057










Molecular Recognition Features






MoRF SequenceStartStop




1) QMRKPSFGKQGGGAKG
1029
1044