<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26036
| Description |
Mediator of RNA polymerase II transcription subunit 18 |
| Sequence | MYEVFLSTIVADEDIKATCSILAGLCAMPPWESLHRVLYFKGPSRPNGISNQNSIVKSQRKDVPGLWKDLHQQLSRQSYVIQARYEVFKDKDFGTETPADFDARAGVLRWTDFPDPPHKGSAAQERGHRGDVPVLPRRCRVLSLPSLPAAPDPGRHAPRPRRRLGDGLHPLRSGPRWIFLVKVHVLQDNKPDEILKAHEQLANIRRDLEGVFEFKTFDRRIHDTRVAVEMRNAPAPLPQVIRAT |
| Length | 244 |
| Position | Head |
| Organism | Verticillium alfalfae (strain VaMs.102 / ATCC MYA-4576 / FGSC 10136) (Verticillium wilt of alfalfa) (Verticillium albo-atrum) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Hypocreomycetidae> Glomerellales> Plectosphaerellaceae> Verticillium.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.546 |
| Instability index | 57.18 |
| Isoelectric point | 9.70 |
| Molecular weight | 27723.43 |
| Publications | PubMed=21829347
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP26036
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 56.93| 16| 18| 82| 98| 1
---------------------------------------------------------------------------
82- 98 (25.00/16.37) QARYEVFKDKDFgTETP
102- 117 (31.94/16.59) DARAGVLRWTDF.PDPP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 34.61| 10| 34| 31| 45| 2
---------------------------------------------------------------------------
31- 45 (13.92/25.01) WESLHRVLyfkgpSR
67- 76 (20.69/14.06) WKDLHQQL.....SR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 103.96| 30| 41| 161| 191| 4
---------------------------------------------------------------------------
161- 191 (50.94/32.22) RRRLgDGLHPLRSGPRWIFLVKVHVLQDNKP
205- 234 (53.02/29.23) RRDL.EGVFEFKTFDRRIHDTRVAVEMRNAP
---------------------------------------------------------------------------
|