<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26031
Description |
Mediator of RNA polymerase II transcription subunit 6 |
Sequence | MATAKDPPLDEVQWRAPPIAHHLQGIHSNSVLFYFAESPFFDQSSNNGIYVHQAAFNPQMQAKMFTREQFEAVLSQMPNGVEFRVAHAPADMVTGTGVWVIVKQERERGKGVTPIAHYFLVGENIYQAPTFGDIMNSKIESISESLSKILPAVDSVRDWTPSLGNAYTQPAPTDLARTQPGAPSKEGTPAPETAAPTTKTTSPFANKTTKSALDRLAEESFAIHLRHGGDYIDQNPITGRPGEFHLSSTGRKEKAALCSPRRRRPHHSRSPNLRF |
Length | 275 |
Position | Head |
Organism | Verticillium alfalfae (strain VaMs.102 / ATCC MYA-4576 / FGSC 10136) (Verticillium wilt of alfalfa) (Verticillium albo-atrum) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Hypocreomycetidae> Glomerellales> Plectosphaerellaceae> Verticillium.
|
Aromaticity | 0.08 |
Grand average of hydropathy | -0.539 |
Instability index | 56.50 |
Isoelectric point | 8.63 |
Molecular weight | 30342.75 |
Publications | PubMed=21829347
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364143
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP26031
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 46.20| 12| 18| 161| 172| 1
---------------------------------------------------------------------------
161- 172 (22.99/11.97) PSLGNAYTQPAP
180- 191 (23.21/12.15) PGAPSKEGTPAP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 85.14| 26| 93| 18| 49| 2
---------------------------------------------------------------------------
18- 49 (36.03/37.35) PIAHHLQgIHSNsvlFYfaESPFFDQSSNNGI
114- 139 (49.11/28.81) PIAHYFL.VGEN...IY..QAPTFGDIMNSKI
---------------------------------------------------------------------------
|