<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26029
| Description |
Mediator of RNA polymerase II transcription subunit 4 |
| Sequence | MDEFIDARFERVEKALASLVESVSKYHPYAKQALDLQEADKELSRGLELVQQHQNNHLRLQELRTTSSALDAQIRETLSTLASTRRDITTTHITVHGDEDHYPIKYEELLNYARRISKTTLPPAGVTNGVMFEPATSEDPPAGAVTNGVQSAVTSAAPTPSGAPTPGAPTPGAQTPAAPTPTPQQLPDPSGLNGAPSQPPEQPGAAPGDNPSGAPLGITTALPSGLRDHLDANHGTIFLPWPNEYQIGGGALAACQDLSERGIDPRGYDPVAVAAEAKRREEEDKAAKAELERRKAEETRRKREEWEANQRRRAAEAAQKPEPSATSPAPRRGQECAVPVY |
| Length | 341 |
| Position | Middle |
| Organism | Verticillium alfalfae (strain VaMs.102 / ATCC MYA-4576 / FGSC 10136) (Verticillium wilt of alfalfa) (Verticillium albo-atrum) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Hypocreomycetidae> Glomerellales> Plectosphaerellaceae> Verticillium.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.753 |
| Instability index | 63.92 |
| Isoelectric point | 5.33 |
| Molecular weight | 36680.13 |
| Publications | PubMed=21829347
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP26029
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 64.49| 16| 16| 122| 137| 1
---------------------------------------------------------------------------
127- 145 (21.63/ 6.85) TNGVMFEPATS....edP.PAGaV
146- 163 (20.92/ 6.41) TNGVQ.SAVTS...aapT.PSG.A
170- 192 (21.95/ 7.05) TPGAQTPAAPTptpqqlPdPSG.L
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 41.70| 12| 16| 293| 304| 2
---------------------------------------------------------------------------
293- 304 (20.53/12.08) RRKAEETRRKRE
311- 322 (21.17/12.70) RRRAAEAAQKPE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 50.19| 13| 26| 196| 208| 4
---------------------------------------------------------------------------
196- 208 (27.09/13.73) PSQPPEQPGAAPG
223- 235 (23.11/10.65) PSGLRDHLDANHG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 42.61| 12| 25| 86| 97| 5
---------------------------------------------------------------------------
86- 97 (21.52/12.85) RDITTTHITVHG
114- 125 (21.08/12.46) RRISKTTLPPAG
---------------------------------------------------------------------------
|