Description | Mediator of RNA polymerase II transcription subunit 21 |
Sequence | MTDRLTQLQDAVDQLAQQFVACFHYVNRHHDLEVLGPKDKVRDVTKGASQLEVEPADAEEFRAGLLELSRDLIVKEQQIEVLISTLPGLDTSEADQEKNVRELEEELKIAEVQRQEAIKEKDQILVKLAEVIRNVRRP |
Length | 138 |
Position | Middle |
Organism | Verticillium alfalfae (strain VaMs.102 / ATCC MYA-4576 / FGSC 10136) (Verticillium wilt of alfalfa) (Verticillium albo-atrum) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Hypocreomycetidae> Glomerellales> Plectosphaerellaceae> Verticillium. |
Aromaticity | 0.03 |
Grand average of hydropathy | -0.523 |
Instability index | 44.48 |
Isoelectric point | 4.81 |
Molecular weight | 15809.71 |
Publications | PubMed=21829347 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 ARBA:ARBA00003669 ECO:0000256 RuleBase:RU366036 |
GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule |
GO - Biological Function | |
GO - Biological Process |
Binary Interactions |
Repeats | >MDP26028 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 53.69| 18| 18| 97| 114| 1 --------------------------------------------------------------------------- 89- 106 (27.00/16.56) LDTSEADQEKNVRELEEE 107- 124 (26.68/16.29) LKIAEVQRQEAIKEKDQI --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) DQEKNVRELE 2) GLLELSR 3) TLPGLDT | 95 64 85 | 104 70 91 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab