Description | Mediator of RNA polymerase II transcription subunit 19 |
Sequence | MSFHPQTPQSPSQLSPGTSDLASSMNSSLTSLTTLPTPAHSVNGSTSHPPDTSHDYAMGDDTPQKRKRSIGDVGERDQKKPHVEDGKLDIDDLHQDVGEKYLLCQTPHRTQEFPCITEDLFEMFGLTDIAAEVAREKSNGDKTIKNGLRKTYKGHIKRLGIMGRFDSVAQEWEEPEEVDDDGDQDEDDRPTQKKEKSNEPYFGFGKIMNLSDPEFWHGRSYLMHGLTPRARAELPKALAMAKGQIPEGFDASVLNDDSSRPAAAARSAAPGTPIGTPGSNMGQLKQAQGIPRPQRVNKKRGYGDNSFEGYEGYEDGYATGRWRRPWEVRSAEKKAVGTPPVPEWHAPPILRVRNRGLG |
Length | 358 |
Position | Head |
Organism | Verticillium alfalfae (strain VaMs.102 / ATCC MYA-4576 / FGSC 10136) (Verticillium wilt of alfalfa) (Verticillium albo-atrum) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Hypocreomycetidae> Glomerellales> Plectosphaerellaceae> Verticillium. |
Aromaticity | 0.07 |
Grand average of hydropathy | -0.968 |
Instability index | 47.45 |
Isoelectric point | 5.92 |
Molecular weight | 39618.46 |
Publications | PubMed=21829347 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP26027 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 301.01| 86| 126| 41| 128| 2 --------------------------------------------------------------------------- 6- 103 (123.02/70.84) .QTPQSPSQLS........PGTSDLASSMnsSLTS.............................lttlptpahSVNGSTSHPPDTSH...DYAMG.DDTPQK..RKRSIGDvgERDQKKPHVEDGKLDIDDLHQDVGEKYLL 104- 223 (123.51/66.06) CQTPHRTQEFP........CITEDLFEMF..GLTDiaaevareksngdktiknglrktykghikrlgimgrfdSVAQEWEEPEEVDD...DGDQDeDDRPTQ..KK.......EKSNEPYFGFGKIMNLSDPEFWHGRSYLM 225- 304 (54.48/24.58) GLTPRARAELPkalamakgQIPEG.FDAS..VLND...........................dssrpaaaarsAAPGTPIGTPGSNMgqlKQAQG.IPRPQRvnKKRGYGD............................... --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) AEKKAV 2) PVPEWHAPPILRVRNRGLG 3) PYFGFGKIM 4) RWRRPWEVR | 331 340 200 321 | 336 358 208 329 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab