<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26027
| Description |
Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MSFHPQTPQSPSQLSPGTSDLASSMNSSLTSLTTLPTPAHSVNGSTSHPPDTSHDYAMGDDTPQKRKRSIGDVGERDQKKPHVEDGKLDIDDLHQDVGEKYLLCQTPHRTQEFPCITEDLFEMFGLTDIAAEVAREKSNGDKTIKNGLRKTYKGHIKRLGIMGRFDSVAQEWEEPEEVDDDGDQDEDDRPTQKKEKSNEPYFGFGKIMNLSDPEFWHGRSYLMHGLTPRARAELPKALAMAKGQIPEGFDASVLNDDSSRPAAAARSAAPGTPIGTPGSNMGQLKQAQGIPRPQRVNKKRGYGDNSFEGYEGYEDGYATGRWRRPWEVRSAEKKAVGTPPVPEWHAPPILRVRNRGLG |
| Length | 358 |
| Position | Head |
| Organism | Verticillium alfalfae (strain VaMs.102 / ATCC MYA-4576 / FGSC 10136) (Verticillium wilt of alfalfa) (Verticillium albo-atrum) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Hypocreomycetidae> Glomerellales> Plectosphaerellaceae> Verticillium.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.968 |
| Instability index | 47.45 |
| Isoelectric point | 5.92 |
| Molecular weight | 39618.46 |
| Publications | PubMed=21829347
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP26027
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 301.01| 86| 126| 41| 128| 2
---------------------------------------------------------------------------
6- 103 (123.02/70.84) .QTPQSPSQLS........PGTSDLASSMnsSLTS.............................lttlptpahSVNGSTSHPPDTSH...DYAMG.DDTPQK..RKRSIGDvgERDQKKPHVEDGKLDIDDLHQDVGEKYLL
104- 223 (123.51/66.06) CQTPHRTQEFP........CITEDLFEMF..GLTDiaaevareksngdktiknglrktykghikrlgimgrfdSVAQEWEEPEEVDD...DGDQDeDDRPTQ..KK.......EKSNEPYFGFGKIMNLSDPEFWHGRSYLM
225- 304 (54.48/24.58) GLTPRARAELPkalamakgQIPEG.FDAS..VLND...........................dssrpaaaarsAAPGTPIGTPGSNMgqlKQAQG.IPRPQRvnKKRGYGD...............................
---------------------------------------------------------------------------
|