Description | Mediator of RNA polymerase II transcription subunit 15 (Fragment) |
Sequence | MRKAGVAHSKSSKDMESHVFLKAKTRDEYLSLVARLIIHFRDIHNKKSQASVSDPMNALQSLTGGPAAGAAGIGMPPRGPGQSLGGMGSLGAMGQPMSLSGQPPPGTSGMAPHSMAVVSTATPQ |
Length | 124 |
Position | Tail |
Organism | Homo sapiens (Human) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Euarchontoglires> Primates> Haplorrhini> Catarrhini> Hominidae> Homo. |
Aromaticity | 0.02 |
Grand average of hydropathy | -0.251 |
Instability index | 44.85 |
Isoelectric point | 10.20 |
Molecular weight | 12676.46 |
Publications | PubMed=10591208 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364148 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro nucleoplasm GO:0005654 IDA:HPA |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP26021 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 67.92| 18| 20| 60| 79| 1 --------------------------------------------------------------------------- 60- 77 (36.04/17.27) QSLTGGPAAGAAGIGM.....PP 82- 104 (31.88/ 9.66) QSLGGMGSLGAMGQPMslsgqPP --------------------------------------------------------------------------- |
Disease | neurodegenerative diseases PMID:25564654 |
MoRF Sequence | Start | Stop |
1) IGMPPR 2) YLSLVARLIIHFRDIHNKKS | 73 29 | 78 48 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab